Monday, May20, 2019 L-36.com

Raymarine Smart Controller User Guide 81243 4 en



Note:

This is a new page for displaying documents. The first time a document is loaded will take a little longer than it will for the next person so please be patient if it takes time. It will be much faster once all the documents have been converted. This will also allow these documents to display on devices without pdf viewers specifically mobile devices. Please email me at "L-36" dot COM if you notice any strange behavior. This is part of the Google requirement that all web pages be "mobile friendly". This is an effort that takes quite a bit of time and as it is just me and I would rather be sailing...

Note also that some documents have blank pages. Just click on "Next Page" if that happens.
Previous Page    Next Page

PDF to Text.

SmartControllerUser Guide            Welcome to the SmartControllerHandbooks can be such daunting things cant they Please dont worry we have made this guide as simple as possibleYour guide contains an explanation on how to use your SmartController so finding your way around will become second natureIf all you want to do is power up and get going thats fine But if you want to know more about what your SmartController will do for you youll find it hereDocument Number 812433Date March 2006812433book  Page 1  Wednesday March 29 2006  404 PM3N869s1RzVUN2EEXYEXY017332aEXYEXY01737545432  0WNSG4J025EXYEXY 01543232672WL4WV9UE3EM5ogN9 1EXYEXY017326542Ifhttpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10ccEDYXERXDYYeBadcEeEEeEvhb  dEeE bch aeeDdD acEeE bch aeceDaDcETXceDaaEaDYCKEeEEeEvhb  CEeE bch aeeDCD KEeE bch aeKeDDKETXKeDEaDYKRBKPXBYCXBYCXYBpCXYBBCXAAYBBCXYBBEiDEiDEiDEiDssstssstuussttuEiDsstKSKFQZXEDYuuuuuuuuCXouuYCXouuYCXuYttttEDssttuuEDsEDstEDstusssssuuusuuuuuuuuCXAc3SEiDttuuYCX205282af282SZ282EN282A223A22222222EiDtuYssuutstsssttssstssussEiDssstssusMF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U39kkjvVwhfECedY vZuQRRaymarine SmartControllerSmartController812433book  Page 2  Wednesday March 29 2006  404 PMRUser GuideGetting StartedHow do I power the unit onoff 7Keylock 7Using your SmartControllerHow do I view instrument data 9How do I see all the available data 10How do I use the autopilot 11How do I automatically steer straight 12How do I follow a route  from my GPS 13How do I follow a circle pattern 14How do I follow a zigzag pattern 15How do I follow a cloverleaf pattern 16How do I steer to a fixed wind angle 17How do  I tack using the autopilot 18How do I dodge an obstacle 19Setting up your SmartControllerHow do I change a favourite page 21How do I change the page layout 22How do I change page content 23How do I show or hide pages 24How do I change the pattern direction 25How do I change my boat type  26How do I adjust the handset settings27Alarms and TroubleshootingHow do I set up alarms 29SmartController Alarm messages 31Fault finding 33General maintenance 34Product Support 37Important Safety InformationIntended Use 42Declaration of Conformity 42EMC Guidelines 42Handbook Information 43812433book  Page 3  Wednesday March 29 2006  404 PMRaymarine SmartController    started   812433book  Page 4  Wednesday March 29 2006  404 PMRUser GuideBattery power and signal strengthThe battery power 5 levelsindicated on the left hand side of the display Your SmartController will sound an alarm when battery power is running lowWireless signal strength is shown similarly on the right hand side of the displayCharging the SmartControllerBefore using the SmartController for the first time you will need to charge the unit To charge the SmartController simply place it into the cradle pull open the rubber cover on the base  and connect the charging cable CAUTION  Do not use any other cable to charge the unitThe battery power indicator will flash during charging The recommended charge time is approximately five hours Once fully charged the battery indicator will stop flashingThe SmartController can also be charged whenever you wish without affecting performance812433book  Page 5  Wednesday March 29 2006  404 PMRRRaymarine SmartControllerYour SmartControllerPILOT  Use to activate the autopilotExit cancel or back When off press to power on the ACTION Performs softkey functionset of valuesNAVIGATE STARBOARDUse in PILOT mode to power steer your boat Press and hold for Smart SteerSTANDBY  control of your boat when in PILOT modemodeNAVIGATE PORT Use in PILOT modeto power steer your boat Press and812433book  Page 6  Wednesday March 29 2006  404 PMRUser GuideHow do I power the unit onoffPower onPress and hold the button The handset will beep the display will show the first instrument data page and youre ready to goPower offPress and hold the  button for 3 seconds The display will countdown to zero and will then go blank Note  You cannot power off the handset when the autopilot is in control of your boatKeylockWhen using your SmartController you can temporarily lock the autopilot keys to ensure that it is not accidentally operated Access to the instrument pages is unaffected by the keylockHow do I activate the keylockPress and hold the mode button until you see the KEYLOCK ACTIVE message A key symbol will also be displayed on the instrument data pagesNote  You cannot activate keylock when the autopilot is in control of your boatHow do I turn off the keylockmode followed by unlock A KEYLOCK OFF message will be displayed812433book  Page 7  Wednesday March 29 2006  404 PMRaymarine SmartControllerSmartController812433book  Page 8  Wednesday March 29 2006  404 PMRUser GuideHow do I view instrument dataYour SmartController can display up to 8 pages of boat information Each page can be set to show 12 or 4 data items or to view information graphically When the autopilot is enabled an extra P page is added to the favourites showing autopilot specific informationFrom the main instrument display1 Press the  key to page2 The number of the page hand corner3 Press the softkey to Example Screens             47FT           11KTSXTE       035NMBTWDTWIf you only ever use a few favourite pages usethe PAGE ONOFF feature to turn off the rest812433book  Page 9  Wednesday March 29 2006  404 PMRRaymarine SmartControllerHow do I see all the available dataYou can display all the available SeaTalk data in a list for reference This is particularly useful when checking the availability of data or SHOW ALL DATA                ALL DATADEPTH   47  FTSPEED            11 KTSSOG              97  KTSVMG W    KTSBACKWhen planning your favourite pages use SHOWALL DATA to see what data will be shownFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toSHOW ALL DATA and press the SELECT softkey3 All of the available SeaTalk data present value Use the updown key to scroll through the data Where the is no data present Example Screen812433book  Page 10  Wednesday March 29 2006  404 PMRUser GuideYou can change your boat type in the autopilotYour autopilot can steer your boat according to one of its preset modes The modes that are available are dependant on your boat and autopilot type Each of these are explained on the following pagesAvailable modesPOWERFISHINGSAILAUTOAUTOAUTOZIGZAGCLOVERTRACKTRACKTRACKTACK812433book  Page 11  Wednesday March 29 2006  404 PMRRaymarine SmartControllerHow do I automatically steer straightFrom any screen1 Steer your boat onto the desired 2 Check that there are no obstructions 3 Press the PILOT key to activate PILOTActivates autopilot inAUTO modeSTANDBYTo continue on your current heading under autopilot control use the AUTO mode This will steer you in a straight line ahead until commanded otherwise AUTO mode can be used in conjunction with SMARTSTEER to give you remote powersteering control of your boatAUTO mode is also available for selection viaAUTO812433book  Page 12  Wednesday March 29 2006  404 PMRUser GuideHow do I follow a route from my GPSTRACKactivates autopilotin TRACK modeyou reach TRACKPress when asked toPILOTPILOTPress when asked toYour autopilot can follow a route that you have previously set on your GPS or Chartplotter Ensure that your GPSChartplotter is sending valid SeaTalk or NMEA 0183 dataFrom any screenTRACK is displayedPILOT to activate TRACK mode3 If a valid route is received the it will steer to Press PILOT Note  At each waypoint required Press PILOT PILOT812433book  Page 13  Wednesday March 29 2006  404 PMRRaymarine SmartControllerHow do I follow a circle patternWhen you select CIRCLE mode your current position is marked as the center of the circle pattern Your autopilot will now gently steer your boat into the circle of the selected sizeFrom any screen2 Use the STARBOARD keys to change the size S M or L3 Press the PILOT key to activate Sml Med or Largeactivates autopilotPILOTIf your circles are gradually becoming larger increase812433book  Page 14  Wednesday March 29 2006  404 PMRUser GuideZIGZAGFrom any screenZIGZAG is displayed2 Use the STARBOARD keys to change the size S M or L3 Press the PILOT key to activate Sml Med or Largeyou reach ZIGZAGactivates autopilotin ZIG ZAG modePILOTWhen you enter ZIGZAG mode the autopilot will use your current position and heading as the center line of the zigzag The autopilot Fishing patterns are designed to work at speeds up to 15kts Check your speed before starting812433book  Page 15  Wednesday March 29 2006  404 PMRRaymarine SmartControllerHow do I follow a cloverleaf patternWhen you enter CLOVERLEAF mode the autopilot will use your current position as the center point The autopilot will then steer your boat through a series of starboard turns repeatedly intersecting the CLOVERLEAFSml Med or Largeyou reach CLOVERLEAFactivates autopilotin CLOVERLEAF modePILOTFrom any screenCLOVERLEAF is displayed2 Use the STARBOARD keys to change the size S M or L3 Press the PILOT key to activate You can change the pattern direction in PILOT SETUP See section 3812433book  Page 16  Wednesday March 29 2006  404 PMRUser GuideHow do I steer to a fixed wind anglePILOTyou reach WINDactivates autopilot incurrent wind angleIf your boat is equipped with a wind transducer you can set the autopilot to steer at a fixed angle to the wind WIND mode You can adjust this angle to suit your needsFrom any screenPILOT to activate WIND mode3 The current wind angle will be displayed Use the STARBOARD keys to change For best results when heading upwind sail slightly812433book  Page 17  Wednesday March 29 2006  404 PMRRaymarine SmartControllerHow do I tack using the autopilotWhen in WIND mode you can use the autopilot to execute a tack maneuver The degree of turn is set by the autopilot Refer to the TACKPILOTFrom any screenTACK is displayed2 Use the STARBOARD keys to select the TACK directionPILOT you reach TACKTACK maneuver812433book  Page 18  Wednesday March 29 2006  404 PMRUser GuideHow do I dodge an obstacleWhen used with SMARTSTEER enabled autopilots thepressandhold command will activate SMARTSTEEREven when the autopilot is activated you are are still able to override it If for example you encounter an obstacle or you just wish to change direction by a few degrees This allows you to effectively powersteer your boatWith the autopilot activated1 A brief press of the STARBOARD key will make a direction Use this method for 2 A press and hold of the STARBOARD key will 3 The autopilot will resume on With the autopilot activatedSTANDBY812433book  Page 19  Wednesday March 29 2006  404 PMRRaymarine SmartController    Setting upyour SmartController812433book  Page 20  Wednesday March 29 2006  404 PMRUser GuideHow do I change a favourite pageCHANGE PAGESYou can change the appearance content and layout of up to 8 favourite data pages Set these up to best suit your boating needsWhen viewing a favourite page Press and hold theThe selected favourite page can now be configuredFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toCHANGE PAGES and press the SELECT softkey3 Using the updown key scroll to and press the SELECT softkeyACCEPTCONTENTLAYOUTPAGE OFFPAGE 1812433book  Page 21  Wednesday March 29 2006  404 PMRRaymarine SmartControllerHow do I change the page layoutThe selected favourite page can now be configuredYou can change the layout of each favourite pageIf you only ever use a few favourite pages usethe PAGE ONOFF feature to turn off the restLAYOUTFrom the change page screenselects the next available layoutACCEPTFrom the change page screen1 Using the updown key scroll toLAYOUT2 Press the CHANGE softkey to options The icon to the left 3 Press the ACCEPT softkey to pageXTE       035NMBTWDTWACCEPTCONTENTLAYOUTPAGE OFFPAGE 1812433book  Page 22  Wednesday March 29 2006  404 PMRUser GuideHow do I change page contentACCEPTYou can change the content of each favourite  pageIf you only ever use a few favourite pages usethe PAGE ONOFF feature to turn off the restFrom the change page screenACCEPTDATADEPTH  47FTSPEED  11KTSAWS  23KTSExample screenFrom the change page screen1 Using the updown key scroll CHANGE softkey The current 2 The selected data element will background Where you have displayed use the softkey to wish to change3 Use the updown control to scroll through the available selection When complete press the ACCEPT softkey to save 812433book  Page 23  Wednesday March 29 2006  404 PMRRaymarine SmartControllerHow do I show or hide pagesuse a larger display size to make it stand outUse as many or as few data pages as you like The page onoff option allows you to only display those data pages you really want to seeExample screenACCEPTCONTENTLAYOUTPAGE OFFPAGE 1PAGE ONOFFFrom the change page screenToggles Page OnOffFrom the change page screen1 Using the updown key scroll toPAGE ON or PAGE OFF2 The label displayed indicated selected page This will also the icon 3 Press the CHANGE softkey to 812433book  Page 24  Wednesday March 29 2006  404 PMRUser GuideHow do I change the pattern directionPILOT SETTINGSPATTERNYou can change the autopilot pattern directionExample screenTurns to starboard clockwisepattern directionFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toPILOT SETTINGS and press the SELECT softkey3 Use the updown key to scroll down to the PATTERN option between CLOCKWISE and ANTICLOCKWISE patterns When you are done press BACK to return AUTOLEARN  STARTBOAT TYPE FISHINGPILOT ENABLEDSETTINGS CHANGEPATTERN CLOCKWISEBACKPILOT SETTINGS812433book  Page 25  Wednesday March 29 2006  404 PMRRaymarine SmartControllerHow do I change my boat type If you own a powerboat and still require windinformation set the boat type to SAILExample screenPILOT SETTINGSBOAT TYPEPOWER FISHING SAILYour SmartController can be set to suit the type of vessel to which it is fitted This ensures that the user interface will offer you the most relevant features AUTOLEARN  STARTBOAT TYPE FISHINGPILOT ENABLEDSETTINGS CHANGEPATTERN CLOCKWISEBACKPILOT SETTINGSFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toPILOT SETTINGS and press the SELECT softkey3 Use the updown key to scroll down to the BOAT TYPE between POWER FISHING and SAIL types When you are done press BACK to return to the 812433book  Page 26  Wednesday March 29 2006  404 PMRUser GuideHow do I adjust the handset settingsTo extend battery life set the backlight to theExample screenYour SmartController can be set to display information appropriate to your current location in the format you require The User Settings menu allows you to set this up  HEADING  MAGDATE USTIME 24 HRTIME OFFSET 50HBACKLIGHT 10SCONTRAST 12BACKUSER SETTINGSFrom the main instrument display1 Press the MENU softkey to using the updown key scroll the SELECT softkey2 Use the updown key to scroll to the item you wish to change  setting value3  When you are done press BACK to return to the main 812433book  Page 27  Wednesday March 29 2006  404 PMRRaymarine SmartController    Troubleshooting812433book  Page 28  Wednesday March 29 2006  404 PMRUser GuideHow do I set up alarmsYou can configure which alarms to you want the SmartController to report From the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll SELECT softkey3 Using the updown key scroll to and press the SELECT softkeyWP ARRIVALLOST FIXPILOTLOW WINDBACKLOCALSYSTEMSYSTEMSYSTEMExample Screen812433book  Page 29  Wednesday March 29 2006  404 PMRRaymarine SmartControllerHow do I set up local and system alarmsWhere applicable local alarm threshold values can also be set From the main instrument display1 Press the CHANGE softkey to SYSTEM  alarms to a value set   Alarm not reported3 For LOCAL alarms use the updown key to adjust the alarm threshold valueLOCAL ALARMBACKExample Screen812433book  Page 30  Wednesday March 29 2006  404 PMRUser GuideSmartController Alarm messagesWhen the SmartController detects a fault or failure on the system it will activate one of the alarm messages listed in the following table Unless otherwise stated you should respond to the alarm by pressing standby to clear the alarm and return to manual control before you attempt to resolve the problem In some situations the SmartController will raise more than one alarm When you have dealt with the first alarm it will display the next alarmALARM MESSAGEPOSSIBLE CAUSE and SOLUTIONCHECK PILOTSee the main autopilot display head for information on this  alarmCURRENT LIMITSerious drive failure  the drive is taking too much current due to shortcircuit or jamming Check the drive unitDRIVE STOPPEDThe autopilot is unable to turn the rudder this occurs if the weather load on helm is too high or if the rudder position sensor has passed beyond the preset rudder limits or rudder endstopsCheck drive and rudder position sensorLARGE XTEThis alarm will sound when you are more than 03nm from your planned track The alarm will also state  if you are to the PORT or STARBOARD of the trackLRN FAIL 1 2 or 4AutoLearn not completed successfully Failure codes1  AutoLearn has not been carried out2  AutoLearn failed usually due to manual 4  AutoLearn failed probably due to drive or compass failureRepeat the AutoLearn procedure 812433book  Page 31  Wednesday March 29 2006  404 PMRaymarine SmartControllerMOT POW SWAPPEDMotor cables are connected to power terminals and power cables are connected to motor terminals computer Turn off power and swap over connectionsNO DATAThe autopilot is in Track mode and the autopilot is not receiving SeaTalk navigation data or  your GPS is receiving a low strength signal this will clear when the signal improvesNote The autopilot stops adjusting the heading as soon as it loses dataNO GPS COGThe autopilot is not receiving valid COG data from your GPS system Check the connections and that your GPS unit is setup to send out COG NO GPS FIXYour GPS is receiving a low strength signal this will clear when the signal improvesNO PILOTThe controller is not receiving data from the autopilot Check connections and check course computer is switched onOFFCOURSEThis alarm sounds if you have been off course from the locked heading for more than 20 seconds It also states if you are to the PORT or STARBOARD of the intended headingREGISTRATION INCOMPLETEThe registration of your new handset cannot be completed as the system has detected other handsets in the vicinity1 Switch off all other remote handheld units and repeat the registration process2 If this error  persists take your boat to open water with no other vessel within 100 ftrepeat the registration process RG FAILGyroPlus yaw sensor has failed Call a Raymarine service agentALARM MESSAGEPOSSIBLE CAUSE and SOLUTION812433book  Page 32  Wednesday March 29 2006  404 PMUser GuideFault findingAll Raymarine products are designed to provide many years of troublefree operation We also put them through comprehensive testing and quality assurance procedures before shippingIf a fault occurs with your SmartController use the fault finding tables in this section to help identify the problem and provide a solution If you cannot resolve the problem yourself refer to the product support information ROUTE COMPLETEThis sounds on the completion of a track Press PILOT to continue on the same heading or STANDBY for manual controlSHIPS BATTERYThe ships battery voltage has dropped below acceptable limits replace the batteriesWAYPOINT ADVANCEYou have arrived at a waypoint on your route The autopilot is now requestiong permission to turn onto the next leg press PILOT to acceptSYMPTOMPOSSIBLE CAUSE and SOLUTIONDisplay is blankNo power  press  to power up the SmartController or charge the batteriesAutopilot not respondingDrive the boat for 30 seconds at above 25kts and retryCheck autopilot connectionsBoat turns slowly and takes a long time to come onto courseRudder gain too low Complete AutoLearn or increase gain settingBoat overshoots when turning Rudder gain too high Complete AutoLearn or decrease gain settingPosition information not receivedNavigator not transmitting the correct position dataThe pilot will not auto advance to the next waypointNo bearing to waypoint information received from the navigatorALARM MESSAGEPOSSIBLE CAUSE and SOLUTION812433book  Page 33  Wednesday March 29 2006  404 PMRaymarine SmartControllerGeneral maintenanceRoutine checksThe SmartController does NOT contain any userserviceable parts If you remove the main cover you will invalidate the warranty  It should be serviced only by authorized Raymarine service technician As a result user maintenance is limited to the following checksmake sure all cable connectors are firmly attachedexamine for signs of wear or damage  replace any damaged cablesCleaning the SmartControllerTake care when cleaning the display Avoid wiping the display screen with a dry cloth as this could scratch the screen coating If necessary only use a mild detergentNever use chemical or abrasive materials to clean the controller If it is dirty wipe it with a clean damp clothDealer Maintenance ProceduresThis section includes procedures that have a significant impact on autopilot operation and can affect your boats safety You will not need to follow these procedures in normal operation We therefore recommend that these are only performed by authorised service personnelAccessing the dealer calibration areaFrom the MAIN MENU mode press and hold SELECT for 5 seconds until the dealer calibration screen is displayedUse the updown key to scroll through the various calibration optionsDIAGNOSTICREGISTRATIONBACK812433book  Page 34  Wednesday March 29 2006  404 PMRUser GuideHardware and Software version numbersUse this option to display the current hardware revision and the software version numbers for the SmartController At VERSION press the key to display the informationSelf test to start the unit test sequence and then follow the onscreen instructions This will test the display buzzer and button functionsDiagnosticsPILOT to display the the status of the wireless linkHandset RegistrationRaymarine wireless systems require each wireless controller to be  registered to a basestation This registration process is to prevent unauthorised control of your boat by another wireless user Note  There may be instances where you want to move your controller to another boat and use it with another system In this case you will need to deregister from the current system and register with the new system You can do this using the REGISTRATION functionTo register a handsetAt REGISTRATION press If the SmartController is not registered then the display will read HANDSET NOT REGISTERED Press  to start the registration processThe SmartController will now search for the basestation you can press  at any time to stop the search When the basestation is found by the SmartController and registration is complete the display will read REGISTERED TO BASESTATIONCANCELREGNOT812433book  Page 35  Wednesday March 29 2006  404 PMRRaymarine SmartControllerNote  For successful registration ensure that all other handheld units on your boat are turned off If you try to register a new handset with others active you will see a REGISTRATION INCOMPLETE messageTo deregister a handsetAt REGISTRATION press SELECTIf the SmartController is already registered then the display will read REGISTERED TO BASESTATION  Press DEREG to continue or  to cancel the operationThe SmartController will attempt to commuicate with the basestation and deregister When complete the display will read HANDSET NOT REGISTEREDIf the SmartController cannot communicate with the basestation then a BASE NOT FOUND message will be displayed It is still possible to deregister the SmartController at this point by pressing  SELECT To leave without deregistering press EXITFactory ResetThis option will clear all settings from the SmartController Press and hold  key for 2 seconds to activate the resetNote  A reset does not alter the registration status of the SmartControllerCONTINUEREGISTRATIONINCOMPLETESEE MANUALEXITDEREGBASESTATIONREADY TO USE812433book  Page 36  Wednesday March 29 2006  404 PMRRUser GuideProduct SupportRaymarine products are supported by a worldwide network of distributors and Authorized Service Representatives If you encounter any difficulties with this product please contact either your national distributor service representative or the Raymarine Technical Services Call Center Refer to the back cover or wwwraymarinecom for contact details If you cannot trace or rectify the fault contact your nearest Raymarine dealer or Service Center specifyingThe SmartController serial numbersthe controller serial number is printed on its rear coverthe controller software version numbers812433book  Page 37  Wednesday March 29 2006  404 PMRaymarine SmartController    Information812433book  Page 38  Wednesday March 29 2006  404 PMRUser GuideProduct installationThis equipment must be installed and operated in accordance with the instructions contained in this handbook Failure to do so could result in poor product performance personal injury andor damage to your boat Before installing the SmartController and basestation check that they are the correct voltage for your boats supply As correct performance of the boats steering is critical for safety we STRONGLY RECOMMEND that an Authorized Raymarine Service Representative fits this product WARNING  Electrical safetyMake sure the power supply is switched off before you make any electrical connections WARNING  CalibrationWe supply this product calibrated to default settings that should provide initial stable performance for most boats To ensure optimum performance on your boat you must complete the AutoLearn procedure as described in your autopilot handbookWARNING  Navigation aidAlthough we have designed this product to be accurate and reliable many factors can affect its performance As a result it should only be used as an aid to navigation and should never replace common sense and navigational judgement Always maintain a permanent watch so you can respond to situations as they develop 812433book  Page 39  Wednesday March 29 2006  404 PMRaymarine SmartControllerWARNING  Autopilot controllerIf the wireless controller is your only method of operating the autopilot ensure that your system includes a readily accessible method of switching off the autopilot power supplyYour SmartController will add a new dimension to your boating enjoyment However it is the skippers responsibility to ensure the safety of the boat at all times by following these basic rulesEnsure that someone is present at the helm AT ALL TIMES to take manual control in an emergencyMake sure that all members of crew know how to disengage the autopilotRegularly check for other boats and any obstacles to navigation  no matter how clear the sea may appear a dangerous situation can develop rapidlyMaintain an accurate record of the boats position by using either a navigation aid or visual bearingsMaintain a continuous plot of your boats position on a current chart Ensure that the locked autopilot heading will steer the boat clear of all obstacles Make proper allowance for tidal set  the autopilot cannotEven when your autopilot is locked onto the desired track using a navigation aid always maintain a log and make regular positional plots Navigation signals can produce significant errors under some circumstances and the autopilot will not be able to detect these errorsGeneral Care and SafetyDo not leave the controller in places where the temperature could exceed 60C 140FDo not attempt to dismantle the SmartController or any of its accessories812433book  Page 40  Wednesday March 29 2006  404 PMUser GuideOnly use with the lanyard supplied with your SmartController or a spare supplied by RaymarineSwitch off your SmartController system at a refuelling point even if you are not refuelling your own vesselThe operation of some medical electronic devices such as hearing aids and pacemakers may be affected if a controller is used next to them Observe the manufacturers recommendations for such devicesRadio frequency energyYour SmartController and base station both low power radio transmitters and receivers When they are turned on they intermittently receive and transmit radio frequency RFy radio wavesExposure to radio frequency energyThe SmartController is designed not to exceed the limits for exposure to RF energy set by national authorities and international health agencies These limits establish permitted levels of radio wave exposure for the general population An example of a radio frequency exposure guideline and standard that the SmartController is designed to conform to is BS EN 503712002  Generic standard to demonstrate the compliance of lowpower electronic and electrical apparatus with the basic restrictions related to human exposure to electromagnetic fieldsFCC InformationThese devices comply with Part 15 of the FCC Rules Operation is subject to the following two conditions 1ese devices may not cause harmful interference and 2ese devices must accept interference received including interference that may cause undesired operationChanges or modifications to this equipment not expressly approved in writing by Raymarine could violate compliance with FCC rules and void the users authority to operate the equipment812433book  Page 41  Wednesday March 29 2006  404 PMRaymarine SmartControllerWaste from Electrical and Electronic Equipment WEEEectiveThe Waste from Electrical and Electronic Equipment WEEEDirective requires the recycling of waste electrical and electronic equipment Whilst the WEEE Directive does not apply to some of Raymarines products we support its policy and ask you to be aware of how to dispose of this productThe crossed out wheelie bin symbol illustrated above and found on our products signifies that this product should not be disposed of in general waste or landfillPlease contact your local dealer national distributor or Raymarine Technical Services for information on product disposalIntended UseThe Smart Controller and Base Station are part of a Raymarine autopilot and instrumentation system intended for use on leisure vessels and small workboatsDeclaration of ConformityHereby Raymarine UK Ltd declare that the SmartController and Basestation are in compliance with the essential requirements and other relevant provisions of the Directive 19995ECThe original Declaration of Conformity certificate may be viewed on the relevant product page at wwwraymarinecom812433book  Page 42  Wednesday March 29 2006  404 PMRUser GuideEMC GuidelinesAll Raymarine equipment and accessories are designed to the best industry standards for use in the recreational marine environment Their design and manufacture conforms to the appropriate Electromagnetic Compatibility EMCandards but correct installation is required to ensure that performance is not compromised Connection to other equipmentIf your Raymarine equipment is to be connected to other equipment using a cable not supplied by Raymarine a suppression ferrite MUST always be attached to the cable near to the Raymarine unitHandbook InformationTo the best of our knowledge the information in this handbook was correct when it went to press However Raymarine cannot accept liability for any inaccuracies or omissions it may contain In addition our policy of continuous product improvement may change specifications without notice As a result Raymarine cannot accept liability for any differences between the product and the handbook SeaTalk is a Registered Trademark of RaymarineAll other trademarks used in this document are acknowledged Copyright Raymarine UK Ltd812433book  Page 43  Wednesday March 29 2006  404 PMRaymarine SmartController812433book  Page 44  Wednesday March 29 2006  404 PM9kkjvVwhfECedY vZuQF90T1UV3PPlvw666v6w666 w8xvg6Dttt3ywuIv62vwXw  b5B46 X02ldc F6Z46YrNcZTNPfvdJoGI fMGYburvRIu68Tx0wvzqubE9CZkNPeOSvvMT3fxcT24McorbfnEJKcEvYYLJ6XAdobeCommon10AdobeInDesign40AdobeCreativeSuite20httpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10ccEDYXERXDYYeBadcEeEEeEvhb  dEeE bch aeeDdD acEeE bch aeceDaDcETXceDaaEaDYCKEeEEeEvhb  CEeE bch aeeDCD KEeE bch aeKeDDKETXKeDEaDYKRBKPXBYCXBYCXYBpCXYBBCXAAYBBCXYBBEiDEiDEiDEiDssstssstuussttuEiDsstKSKFQZXEDYuuuuuuuuCXouuYCXouuYCXuYttttEDssttuuEDsEDstEDstusssssuuusuuuuuuuuCXAc3SEiDttuuYCX205282af282SZ282EN282A223A22222222EiDtuYssuutstsssttssstssussEiDssstssusMF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3812422book  Page 21  Wednesday October 12 2005  259 PM812422book  Page 21  Wednesday October 12 2005  259 PMlocaKLmaxp nameV3ugpost prep8MF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3httpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10cc812422book  Page 21  Wednesday October 12 2005  259 PM048DHLPTXdhjl4NORPQUVWXST7Avw 3KDKD43441444tttXo0 YXRU KV1BfJKJEONCzY99pssFYZkCU9us99sVss3sMsssWsWsSsAUjaV9b9s9YV9YVJVVV9sssIsUTsAT99s9Rs0s9ssCaV9YsIsIsIsIsIsIsUsAsAsAsA9999RRRRRsD3VsTssBsd19d2ddsozd17XWeUdTsdssj9YHXsi99rd1sVVsKKsD99uqVVV9j9999Y9Y9Y999VJs0SVsVUms9bT9VJs0asUasUTksIsIQVsAVsA9y9YRPVJs09VVNNNyN0NkOk8sEUkQs099sA 011eYAf2NZKA7KPYddZc6PPy2ZZZZYYYAf2KA7KPddZcAKdAQCFFFFHFFFP55XF29294x000vvoR0FFFQ sg29296R2929224x0004x0004x000iiiivvvv222200000000T4FTT4FTppTisU99VQQVsAYVshgyVvFCyVv9VRYRY5U7YasULV4asUrmm9 rsIsIXVsAYsL69YR9VRWk8sssrTzTFCCFJC Cf9bR CwGVtRVjiVVCiSsIasUTTTTTVsAVsAVsAVsAVsA9bTN9999sss99999YR9YR9YR9YRVVYVJs0VJs0VJs0VJs0VJs0VsVs99VsVsVs9ssI9NNNNNNNNCCNNNNNN99999999RRRRRRUUvvvvvvvvbNNNNNNNNNNNN99RRvvNNNNNNNNNNCCNNNNNNNNNNNNNNNWW99999999vvvvvvvvVVJNNNNNejbsaa 0fSSSS99sVTWsrrSSSV5asU9IvRs4RRTKSSvQQQs9KUsv22U2U222rU2222w2x22z222w222222222222 22242H22I2I2 22B22L2C222222B22FFFAT5Oiivv92KAXUfhsUs9aTass92AC242 22T2ATTnnn2AEkFF232A82A0 00Po0zpwwz222222sOst2o2p222A22A02d322222At558P5tAX7 7000   7  A7 07AtttttptttttOztuwpppppzpppptpupwztuwPPPPPzPPPPtPuPwztuw00000z0000t0u0w     z    t u wztuwztuwAztuw0ttztuwztuwztuwztuw     z    t u wX048DHLPTXdhjl4NORPQUVWXST7Avw BUBUBUBUBUBUBUBU BUJDVe0KU2jjjjjjsdtHIsssF9BsssJsHsFsKI24UsLd232222dBBdBdBBdB3ddddd222B22dd22222s922229mVsfAHHHHHHHHZSJVg0HSH9XsHcL9rZZ9990sPppphPPPPPPPPPPDbll1333496rrrrAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAYVjbj51jbD 2011 The Monotype Corporation All Rights ReservedArial is a trademark of The Monotype Corporation 2011 The Monotype Corporation All Rights ReservedHPQIXZArialMTHPQIXZArialMTHPQIXZArialMTArial is a trademark of The Monotype Corporation 2011 The Monotype Corporation All Rights ReservedHPQIXZArialMTRegularHPQIXZArialMTHPQIXZArialMTHPQIXZArialMTArial is a trademark of The Monotype CorporationTCooqscZC0x IiW3ocH8vXoPyIvfIAFNPSNGIRJAEPYaI8BCA6EG3633335561682292c8LoPAxmBrWVnZVRGDKLICDIMFIMGA53GAC63AB200G0066 RlxxyvyxvxtyttxtrrxxxwwtrxyttvvqrqvwvvtvvmotvtrrsuroosuzuouvuwsvvspuuswxnrzznkH4wz7kdPwC8SRPJxhy5XWiOLl45OzmVDkkIfKhs3ynE9rcJnI6Qrjub E41rbJdVU9XoPY2130owDAWcxmZcpxfVJE72 NfxxxtvyvqqtxyxvvspnqorwyutromoprwuoprjkquuomorpumruyvssswyxzxyreSgjdJkrK38uUeFZpFPf09bzodmuM7oaLkTtorwxzzvqvtvzzxxytplvvttwvrwwuupvlnrpkllllnptspmmxvojosuzywwvurolfWEj36mq5yE5Zi5 DzLrwzyukWFxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype140xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype110xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetype40xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetypeAICoolBreezexmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype12xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypedilatexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeaxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype12xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypeaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypedilatexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypebxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypebxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetypebxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeb1xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeb1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypeb1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeb2xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetype02xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetypeb2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype3xmlnodenodevaluescalexmlnodenodenamescalexmlnodeattributesxmlnodechildrenxmlnodenodetypeb1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeb2xmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeb3xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeb3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeRxmlnodenodevaluexChannelSelectorxmlnodenodenamexChannelSelectorxmlnodeattributesxmlnodechildrenxmlnodenodetypeAxmlnodenodevalueyChannelSelectorxmlnodenodenameyChannelSelectorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDisplacementMapxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypematrixxmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype0 0 0 0 0  0 0 0 0 0  0 0 0 1 0  0 0 0 1 0xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypeb3xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeb4xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeb4xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeColorMatrixxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeb4xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeb5xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeb5xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypefreezexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetype5sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluetoxmlnodenodenametoxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluefromxmlnodenodenamefromxmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypestdDeviationxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetypebxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetype005xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluescalexmlnodenodenamescalexmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypec3xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeRxmlnodenodevaluexChannelSelectorxmlnodenodenamexChannelSelectorxmlnodeattributesxmlnodechildrenxmlnodenodetypeAxmlnodenodevalueyChannelSelectorxmlnodenodenameyChannelSelectorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDisplacementMapxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypematrixxmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype0 0 0 0 0  0 0 0 1 0  0 0 0 1 0  0 0 0 1 0xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypec3xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypec4xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec4xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeColorMatrixxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypec4xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypec5xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec5xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypec5xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeb5xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIDilate3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype3xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypedilatexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIDilate6xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype6xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypedilatexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIErode3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype3xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeerodexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIErode6xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype6xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeerodexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIGaussianBlur4xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIGaussianBlur7xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype7xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype50 50xmlnodenodevaluefilterResxmlnodenodenamefilterResxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIPixelPlay1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetype10sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypesplinexmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypefilterResxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetype1 120 15200 200 15 201 1 xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype7xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypecompositeOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetypecompositeOutxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypecompositeOut1xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypecompositeOut1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype50 50xmlnodenodevaluefilterResxmlnodenodenamefilterResxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIPixelPlay2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetype10sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypefilterResxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetype50 5020 2050 50xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype7xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeyellowxmlnodenodevaluelightingcolorxmlnodenodenamelightingcolorxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevalueresultScalexmlnodenodenameresultScalexmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluediffuseConstantxmlnodenodenamediffuseConstantxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetype15sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypelightingcolorxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypeyellowgreenblueindigovioletredorangexmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype180xmlnodenodevalueazimuthxmlnodenodenameazimuthxmlnodeattributesxmlnodechildrenxmlnodenodetype60xmlnodenodevalueelevationxmlnodenodenameelevationxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDistantLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDiffuseLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetyperedxmlnodenodevaluelightingcolorxmlnodenodenamelightingcolorxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevaluespecularExponentxmlnodenodenamespecularExponentxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluespecularConstantxmlnodenodenamespecularConstantxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetype15sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypelightingcolorxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypeindigogreenyellowbluevioletredorangexmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype180xmlnodenodevalueazimuthxmlnodenodenameazimuthxmlnodeattributesxmlnodechildrenxmlnodenodetype60xmlnodenodevalueelevationxmlnodenodenameelevationxmlnodeattributesxmlnodechildrenxmlnodenodetypelightxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDistantLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeSpecularLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaint1xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaint1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIShadow1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype2xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype130xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype140xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIShadow2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype6xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenamein3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroupAIPatternEditorPreviewRowsAIPatternEditorTileHeightAIPatternEditorTopinFrontAIPatternEditorLeftinFrontAIPatternEditorDimCopiesKeyAIPatternEditorPreviewColsAIPatternEditorTileWidthAIPatternEditorEditableCopyLocKeyAIPatternEditorDimPercentKeyNew Pattern 11New Pattern 4Unnamed 6Unnamed Brush Pat 1xmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIAlpha1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbulencexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetype2xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetype005xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIAlpha4xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetype01xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype140xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype140xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetype20xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetype20xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIBevelShadow1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypelightingcolorwhitexmlnodenodevaluestylexmlnodenodenamestylexmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluespecularExponentxmlnodenodenamespecularExponentxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluespecularConstantxmlnodenodenamespecularConstantxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype20000xmlnodenodevaluezxmlnodenodenamezxmlnodeattributesxmlnodechildrenxmlnodenodetype5000xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetype10000xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefePointLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeSpecularLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypespecOutxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypespecOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecOutxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNode1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroupCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35AIPatternIsRepeatedArtAIPatternEditorPreviewRowsAIPatternEditorTileHeightAIPatternEditorTopinFrontAIPatternEditorLeftinFrontAIPatternEditorDimCopiesKeyAIPatternEditorPreviewColsAIPatternEditorTileWidthAIPatternEditorAutoSpacingHAIPatternEditorAutoGrowAIPatternEditorAutoSpacingVAIPatternEditorEditableCopyLocKeyAIPatternEditorDimPercentKeyAIPatternEditorRepetitionTypePompadourPompadourAIPatternEditorBackingTileRect1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83AIPatternIsRepeatedArtUnnamed gradient 353141593BBAccumRotationCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35AIPatternIsRepeatedArtUnnamed gradient 353141593BBAccumRotationCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 353141593BBAccumRotationCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 353141593BBAccumRotationCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Adobe Vectorized ObjectImage TracingVectorizeaipAdobe Flare PluginFlareflareaipAdobe Deform PluginAdobe Envelope PluginEnvelope and WarpaipAdobe Planar GroupAdobe Live Paint PluginLive PaintaipAdobe Perspective Plugin GroupAdobe Perspective Plugin GroupPerspectiveaipAdobe Path BlendsAdobe Blends PluginLive BlendsaipAdobe SymbolismAdobe SymbolismSymbolismaipAdobe PatternOnPath Brush ToolAdobe Pattern Brush PluginArtOnPathaipAdobe PatternOnPath Brush ToolAdobe Pattern Brush PluginArtOnPathaipAdobe ArtOnPath Brush ToolAdobe Art Brush PluginArtOnPathaipAdobe ArtOnPath Brush ToolAdobe Art Brush PluginArtOnPathaipAdobe Calligraphic Brush ToolAdobe Calligraphic Brush PluginCalligraphic Brush ToolaipAdobe Scatter Brush ToolAdobe Scatter Brush PluginScatter Brush ToolaipAdobe Scatter Brush ToolAdobe Scatter Brush PluginScatter Brush ToolaipAdobe Pattern Editor Plugin GroupAdobe Pattern Editor Plugin GroupSwatch LibrariesaipPathfinder SuiteAdobe Compound ShapePathFinder SuiteaipFading SkyFading SkyOrange YellowOrange YellowSuper Soft Black VignetteSuper Soft Black VignetteUnnamed gradient 1Unnamed gradient 1Unnamed gradient 10Unnamed gradient 10Unnamed gradient 14Unnamed gradient 14Unnamed gradient 16Unnamed gradient 16Unnamed gradient 18Unnamed gradient 18Unnamed gradient 19Unnamed gradient 19Unnamed gradient 21Unnamed gradient 21Unnamed gradient 35Unnamed gradient 35Unnamed gradient 4Unnamed gradient 4Unnamed gradient 41Unnamed gradient 41Unnamed gradient 42Unnamed gradient 42Unnamed gradient 5Unnamed gradient 5Unnamed gradient 51Unnamed gradient 51Unnamed gradient 54Unnamed gradient 54Unnamed gradient 8Unnamed gradient 8Unnamed gradient 83Unnamed gradient 83White BlackWhite BlackFoliageFoliagel4s2sM5Dk0fU0dnDrrBbRk4s2sM5Dk1C0dnDru35Jms5hWa1EFru5Pos5hl4s2sM5Dk1U10dnDrrBl4s2sM5Dk1I10dnDsGHB5Jms6r3q4s2sM5Dk1GBql4s2sM5Dk0eje0dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk0fL40dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk0f00dnDrrB0dnDru35Jms5h1EFru45Pos5hbRk4s2sM5Dk10nbRk4s2sM5Dk1L0dnDru35Jms5hWa1EFru45Pos5hl4s2sM5Dk170dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk1g0dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk1GL0dnDru35Jms5h1EFru5Pos5hl4s2sM5Dk1GU0dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk1G0dnDru35Jms5h1EFru45Pos5hbRk4s2sM5Dk1Gg40dnDrrBl4s2sM5Dk1H0dnDru35Jms5h1EFru45Pos5hbRk4s2sM5Dk1HF00dnDrrBbRk4s2sM5Dk1HR20dnDrrBHII1hLr5KHII19taLr5KDuFHII1LcLr5KDuFHII17eLr5KDuFHII1pCgLr5K1DuFHII1GBq5NDuFHII1GUbLr5NDuFHII1Gg4dLr5NFul1H0heD1HF35N1ok1HR35QDuFHII1bg5Qok1c74Q2Mo5CHII2BosCheDheDheDheDRht35CBosCheDheDheDheDRht35CheD1EA0HE5Sp0J50aq5Yr0eP40t5tFE2M85Htq0eje5HdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0HJ5Dk9GOQ1U11U120I04Sht35CdTVb0M24Q2Bos0etUiibW5Gl1atGht35CdTVb04S34Q2BosBheD1U11U15Gl0dYDht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheD20I04Sht35C1BjF04S34Q3Vb0MQB2M2MCC0dq5CdTY4s3Qht34O0HaRB0fC1CC0dS5Gl4O0HaRBhoEECC0dq5C2M2M20I04Sht35Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTb3dTb32M2MCC0dq5CdTG4s3Qht34O0HaRB2XspdTVb0M24Q2Bos1U11U11U15Gl0dYDht35Cht35C20I04Sht35CdTG4s3Qht34O0HaRB2kpdTVb0M24Q2BosBheD1U11U15Gl0dYDht35Cht35Cht35Cht35Cht35Cht35Cht35CZ5Gl4O0HJ5Dk9GUP0Hu2M20I04Sht35Cht35CdTVb0M24Q2BosBheD2MCC0d7p5C20I5C20I5CdTG4s3Qht34O0HaRB2BXqpdTVb0M24Q2BosBheDheDheDR5Gl1AbEht35CdTVb0M24Q2BosBheD2MCR4s3Qht34O0HaRB2BXCC0dS5Dk4O0HaRB0J5ib20I5CdTVb0M24Q2BosBheD2MCR4s3Qht34O0HaRB2BX3CC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTb3dTVb04S34Q2BosBheD2MCC0d7p5Cht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0dS5Dk9GUP0H0HuCC0dq5C0dC4O0HaRB0ejeCC0dS5Gl4O0HaRB0J5iipdTG4s3Qht34O0HaRB0eje0CC0dS5Gl4O0HaRB0J50J50J5pdTP4s3Qht34O0HaRB0eje20I04S34Q3Vb0MQEEECC0dq5CdTVb04S34Q2BosBheDheDheDRht35Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheDheDheDRht35Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheD1U11U15Gl0dYDht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheD20I04Sht35C1BjF04S34Q3Vb0MQB2M2MCC0dq5CdTVb04S34Q2Bos0etUiipdTb3EK5Gl4O0HJ5Dk9GUP0H0H0HaXD04SdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTY4s3Qht34O0HaRB1A1CC0dS5Dk4O0HaRB0J5ib20I5CdTY4s3Qht34O0HaRB1EIrpdTVb04S34Q2BosBheDheDheDRht35CdTP4s3Qht34O0HaRB1EYpdTVb04S34Q2BosBheDheDheDRht35CdTVb04S34Q2BosBheDheDheDRht35CdTb3dTb3ht35CdTG4s3Qht34O0HaRB2XspdTVb0M24Q2Bos1U11U11U15Gl0dYDht35Cht35C20I04Sht35CdTG4s3Qht34O0HaRB2kpdTVb0M24Q2BosBheD1U11U15Gl0dYDht35Cht35Cht35Cht35Cht35Cht35Cht35CZ5Gl4O0HJ5Dk9GUP0Hu2M20I04Sht35Cht35CdTVb0M24Q2BosBheD2MCC0d7p5C20I5C20I5CdTG4s3Qht34O0HaRB2BXqpdTVb0M24Q2BosBheDheDheDR5Gl1AbEht35CdTVb0M24Q2BosBheD2MCR4s3Qht34O0HaRB2BXCC0dS5Dk4O0HaRB0J5ib20I5CdTVb0M24Q2BosBheD2MCR4s3Qht34O0HaRB2BX3CC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTb320I5CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SpdTVb04S34Q2BosBheDheDheDRht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0dS5Dk9GUP0H0HuCC0dq5CdTb3dTG4s3Qht34O0HaRB3U7pdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheDheDRht35C20I04Sht35CdTVb04S34Q2Bos0etUiipdTb31CC0dS5Gl4O0HaRBhoEECC0dq5CdTVb04S34Q2BosBheD1U11U15Gl0dYDht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheD20I04Sht35C2M2MCC0dq5C3LfVb0MibbRk4s2sM5DkM8n0Xurr4dTVb0M24Q2BosBheD2MCC0d7p5CdTY4s3Qht34O0HaRB1AqpdTVb0M24Q2BosBheD2MCC0d7p5C20I04Sht35CdTP4s3Qht34O0HaRB1APpdTVb0M24Q2BosBheD2MCC0d7p5C20I04Sht35CdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J50J50J5pdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CZ5Gl4O0HJ5Dk9GUP0HuMopdTY4s3Qht34O0HaRB1A0CC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTVb04S34Q2BosBheD2MCC0d7p5Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SZ5Gl4O0dS5Dk9GOQ1U11U11U15Gl1atGht35CdTVb04S34Q2Bos0etUiipdTb3dTG4s3Qht34O0HaRB2tpdTVb0M24Q2BosBheD1U11U15Gl0dYDht35Cht35Cht35CdTVb0M24Q2BosBheD1U11U15Gl0dYDht35CdTVb0M24Q2BosBheD1U11U15Gl0dYDht35CdTVb0M24Q2BosBheD1U11U15Gl0dYDht35CdTVb0M24Q2BosBheD1U11U15Gl0dYDht35CdTVb0M24Q2BosBheD1U11U15Gl0dYDht35CdTVb0M24Q2BosBheD1U11U15Gl0dYDht35CdTVb0M24Q2BosBheD1U11U15Gl0dYDht35CdTVb0M24Q2Bos1U11U11U1ht35CdTVb0M24Q2BosBheD2MCC0d7p5C20I5C20I5CdTG4s3Qht34O0HaRB2BXqpdTVb0M24Q2BosBheDheDheDR5Gl1AbEht35CdTVb0M24Q2BosBheD2MCR4s3Qht34O0HaRB2BXCC0dS5Dk4O0HaRB0J5ib20I5CdTVb0M24Q2BosBheD2MCR4s3Qht34O0HaRB2BX3CC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTb32MCR4s3Qht3pdTVb04S34Q2BosBheD2MCC0d7p5Cht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0dS5Dk9GUP0H0HuCC0dq5C0dC4O0HaRB0ejeCC0dS5Gl4O0HaRB0J5iipdTG4s3Qht34O0HaRB0eje0CC0dS5Gl4O0HaRB0J50J50J5pdTP4s3Qht34O0HaRB0eje20I04S34Q3Vb0MQEEECC0dq5CdTVb04S34Q2BosBheDheDheDRht35Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheDheDheDRht35Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheD1U11U15Gl0dYDht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheD20I04Sht35C1BjF04S34Q3Vb0MQB2M2MCC0dq5CdTVb04S34Q2Bos0etUiipdTb3Ful0esk5Hok0f15Hok0fC5HE5HEVXHAKWW3VpBCia104FE2M85KdTBosN4Q2p4s4R5C4Q2BosN4Q2Vb0MQ213AE1d2333JiYgG3rEckq900ZVb0M5Gls5h1AEru25Mns5hbR1a4Gru1ht34O0Hm04Rtrr4bR1a4Gru1ht34O0Hu04Rtrr2u3L9R6h4s0Frr4tq0f94Q2R6h4dXqpLMXO3Lf5HDuFHIX4s2L5BosN4Q2Vb0Lsrr2sedLMXL8RAorkLckD7qagOC2AorhjIJ9YcJA2dZVFcN1ss5O2FUOlD7N3rOC2D8kQVERdJD8AHII1GBq64QgO5NGf2dL0d1AA5N1Gq5CE4s2Lp4s3Q5Gl0f14s2sM5Dk4O0HJ5Dks5q5Sp4O0d0HE5Mn0J50OeheD2S0H1ECia10GFE2M85H0JGF39k1EG1gsK2P0Hl5CdYBosN4Q3TtR5HVb0M3Tt1ok2LCia15CFE2M85H0JGF39k1EG1gsK2P0Hl5CdYBosN4Q3TtR5HVb0M39k0ok2LCia15Cg41EGGl0f32t2FE2M85H0JGF39k1EG1gsK2P0Hl5CCA0Xk74Q2BosN4Q2Vb0M24Q2R6h3L9Vb04SheD1A80HE4s2Lp4s3Q5Gl0eje74s4R5C5Gl0ek75Vq0eP00heD1hLr5KDuFHII1H6L31aG13UFH586ZDagnUFE4jVb0M5Gl9GXQ0H50fCsC2QPCC0ejemEckq90540HPCCR4s4R5CE4s2Lp4s3Q5Gl0fC4s4R5CheD1hLr5KDuFHII1H6L31aG13UFH586ZDagnUFE4jVb0M5Gl9GXQ0HEVXHAKWW1A0J520HPCCR4s4R5C1k70YLr5MnAmoLsAKWWEVXHAKWWPl0HGK5Yr0eP0t5t0J5050J50510d1A7n0570H1aIp050H2BXr05C0J505FFE2M85H0DuFHII1hmEckq9075Gl9GXQ0H0H0H0H5Gl9GXQ0H0H0H0HHII20ta11G10td2AmoLsAKWWc2Rq0tj44O3B838eHsdY3L9p4s3Qht34O0HJ586DerBuEMLWDKIS0HJ5Dks5H9TGEWBeRsgHAZKDZFVSt0o5Jm0HPCht35CheD0eaheD0eje5HHII20ta11G10td2AmoLsAKWWc2Rq0tj44O3B838es04Rtrr2sP3LfVb0Lsrr4G4HAm0dnDrroht34O0HeCrrM5Gls5H29Y34s2sM5Dks6BD0dnDrrcht34O0HeCrrBM5Gls5H1FXG14s4R5C5MniUE5Poi5SpiUE5Vqi5YriOn3Fl4s2sM5Dk1A5bR1a4Gru1ht34O0H1p04Rtrr4bRk4s2sM5Dk2BXYR6h37Ok0Xurr2u13L9R6hkn0Oerr43LfVb0M5Gls5h1AEru25Mns5hbR1a4Gru1ht34O0Ht04Rtrr2u3L9R6h4s0Frr41bUA3E2C2C0eb1bUA7PHMT1C0JG12DgC3AF6SL2P2C2C0eb1bUA7PHMT1C6SL2L0JG17PHMT1C0JG12ZpD3E2C0JG12ZpD3E2pCias6UHE6uR9eFpp7CoVdh4MWVdL6Is9IATCgEbZiFCias6UH6Vd6ZRa8SqmKATLgh7WMpSATJu9Eckq6UH6Vd73EeEObFE296fCias6UH6Vd8TSFYDfBlBl8DJIdWVARnVXDeATJuLr144VdL03Cias6UH6Vd6FLnEc5nkGdfVdLWA7SMFB4XYPAoAfLr144VdL00sZIsK8GdfVdLWDILA7WEOBl7DuFGdfVdLWDILA7MFCfKruFAKYSnCias6UH6Vd8TSFWlFQJVC1UmsemBl7RCh6OVCh7uDfQsRfrVdLW6sGKH4sAThctAISt AI12 Job Options DataMXGht34O0HeCs8QCJ0d1n5Cht34O0HeCsFd67Rht34O0HeCsGIbX0d1n5Cs7r04S4s2sM5Dks65qkSR5Gl1EkFVb0Lsrr4Z0LI9304Sht34O0HeCsHkq74B40d7p5C4s2sM5Dks68MEb5Gl1EkFVb0Lsrr4Z0OlOS04Sht34O0HeCsKZKor0d7p5C4s2sM5Dks6LG4K45Gl1EkFVb0Lsrr440TIS4s2sM5Dks6TeNh5Gl1EkFVb0Lsrr4I0V04Sht34O0HeCsL9VN0d7p5C4s2sM5Dks6WA5Gl1EkFVb0Lsrr4i0Z04Sht34O0HeCsNIejc0d7p5C3L8uGq5CdTY4s3Qht34O0HaRB1AFspdTVb0M24Q2BosBheD1U11U15Gl0dYDht35CEK5Gl4O0HJ5Dk9GUP0H0H0HaXD04SdTVb0M24Q2BosBheDheD20I04Sht35Cht35CdTG4s3Qht34O0HaRB2epdTVb0M24Q2Bos1U11U11U15Gl0dYDht35CEK5Gl4O0HJ5Dk9GOR2M2M20I04Sht35CdTG4s3Qht34O0HaRB2VCC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2VCC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2VCC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V0CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V1CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V2CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V3CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht3pdTY4s3Qht34O0HaRB2BXdupdTVb0M24Q2BosBheDheD20I5CdTP4s3Qht34O0HaRB2BXtpdTVb0M24Q2BosBheDheD20I5CdTVb0M24Q2BosBheDheD20I04Sht35CdTVb04S34Q2BosBheDheD20I04Sht35C064  HjzytzwtttyvwysfIMuvvbIfyyuobUKPekrxyzzxxzzxxxstvtnpuxxtmkgjgegllljgeddfadaXYcdjlhmosu21223783A8620658 KNZYjoucxlamswofelWmyThtoPRhmqnbZYOQkZYZUPUZPIHGHKM210 Mr8  0 AKI816812668EE7JGABFDHddSK  48C6xmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIStaticxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetype05xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetype5sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetype07xmlnodenodevaluetoxmlnodenodenametoxmlnodeattributesxmlnodechildrenxmlnodenodetype05xmlnodenodevaluefromxmlnodenodenamefromxmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypebaseFrequencyxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetypeAITurbulence3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbulencexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetype005xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetypeAITurbulence5xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetype04xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype150xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype150xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIWoodgrainxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypefloodcolorblack floodopacity04xmlnodenodevaluestylexmlnodenodenamestylexmlnodeattributesxmlnodechildrenxmlnodenodetypecolorxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypecolorxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeFloodxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypecolorxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeshadowColorxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypewhitexmlnodenodevaluelightingcolorxmlnodenodenamelightingcolorxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevalueresultScalexmlnodenodenameresultScalexmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluediffuseConstantxmlnodenodenamediffuseConstantxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype135xmlnodenodevalueazimuthxmlnodenodenameazimuthxmlnodeattributesxmlnodechildrenxmlnodenodetype60xmlnodenodevalueelevationxmlnodenodenameelevationxmlnodeattributesxmlnodechildrenxmlnodenodetypelight2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDistantLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDiffuseLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypewhitexmlnodenodevaluelightingcolorxmlnodenodenamelightingcolorxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluespecularExponentxmlnodenodenamespecularExponentxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluespecularConstantxmlnodenodenamespecularConstantxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype135xmlnodenodevalueazimuthxmlnodenodenameazimuthxmlnodeattributesxmlnodechildrenxmlnodenodetype60xmlnodenodevalueelevationxmlnodenodenameelevationxmlnodeattributesxmlnodechildrenxmlnodenodetypelightxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDistantLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeSpecularLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeTurbulencexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetype05xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypematrixxmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype1 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 1xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypeTurbulencexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeGrayscalexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeColorMatrixxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetypeBlurredAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeOffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeGrayscalexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeOffsetBlurredAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompBlurTurbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeCompBlurTurbxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompBlurTurb2xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeGrayscalexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompXferFirexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypetablexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype2 0xmlnodenodevaluetableValuesxmlnodenodenametableValuesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeFuncRxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypetablexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype7 0 xmlnodenodevaluetableValuesxmlnodenodenametableValuesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeFuncGxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypetablexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype1 0xmlnodenodevaluetableValuesxmlnodenodenametableValuesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeFuncBxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeComponentTransferxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeCompXferFirexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompSourceFirexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeMergeAllxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompSourceFirexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenameGerberaIlluminated OrangeUnnamed gradient 425FTUabiddaccyoroottxkBbvvpfnxyuppszulqtlkomzopszvlVtiZWNJPXnzyyrrxtstzviggnnqplmdddhdbdbfdcceeccacacfdjhomlpqluiH DhIvztikxusyvuqpsqxopncypcebexvqtxhesukmZqebhnkfTSdXEJlzrYUKYxZIF7lg727Ze49EMJBIRMB3YE2CPP4387F320iVA40NNJ664NH7648 94     AvmacdrtP      yC72 IY1q   yX  332 00P  ghgUgcmbAyqwxwyzyywzwxuwywxvqxxujqutpuywpszxztojrfqtzzyxxtsspropvwqntutturrwuolokjygtKHvqaWRKGMXfpuyzzzxvvvzxtwzvvoknnqjniiigginngjlmjjjkeipmolhbdhjhehkcemtpotqitC2620 cFNq   1  33w 122   pU  MadzzxxyvtywyzxyzuywuxzxzxyzzuyyoovtxqmrktrsvtmqsyvtsqqvwurtwwzusngmwxsrstrilrttnoutsuuvwpjgmouwtroptrmfmtwunummionnmstwphkiRbuvmVNKOSkzzyzrorttomltxtrtsonqmmlnpqtvtqklikqkjllikjikgfjiffffjlhcfkmjhjoromrstxMcwzxxxuvytwvztvuxxwyvvwuzxvprxxuusvutkpuyonvyuxqwnmsoehsqosrokenrquvrlikossfeiprplpoqpkjooegmpjVywmcWVLJJVmxxzxxtxwvvvvvxzvsrnottsrrrsrqkkorqonjghfgijikopljhkmkkjkheekfeejkjkloopspjmuzpF0wLV 3RtcSqBbHznicgztT2yvvzzyuzvsutytvzzyyvwqkmwyytyvtuuvwuvzwunnbboutzqtvrxrkrxvfnsqrnxuwuttrtyynafxqnjstpptolnsqpslhkmqwtwtlionoojiprqpnljjopuqspqqjiecWEbluvkVISSSmqzxtsytyststtvvxsommmokqsurrommorromllgjkmmjkijkjkkjijokffhcfhfefnlfbdeillltwzwpcqI85NSN2640ADJJTQqvlhtrffhvtaruqeigpenZYilgQK 7uurlcXSUKFE869DCBEKKJGHDHIKKIGGKIAGIHMFOWOQatywyuzxxwtjWPRTVYakoqvxzxxvqorutwqmovttoqqrvxtstvrqqrontvommsqomkiiklhjkhikqihhhhhknnhfgfkrqrpkpsuqNv7wgvpdVBXXXcbLFPc201382DSPDUF6HXM24D5801lI065DUfhxzsoruuyvxvleXTPTYbhmrsrvyvzztvzyxxtrqrtyvvvyxtuovqqttmqqjlopomlmnppmkkkjjmnmkjjkkkjmrrljlkifhkmnlnouttqtwvxyq4sovvnZC3KgjkXZXNF2685AIA12FIGNRPPC33CVYMH1CUZR6DJ6LWI72NH58II482A50  P SxurvvuyyxzvzyzyxzzzxtvxvttyxtuvtvuxutvxtqstsrmmrqqsspppnopmqhkejpqpqmmojnrqmjkmnokknsvtspquwzytjNAzfxiKVzvvzxxxzxvyxxxvvxvvvvxxtqqttvxxvvsqnnnopvnrspmnmqoomnquwwrpsoorurmjnrrqpnmppkilppsusnuyvwxoS6mm9KvqJ3nYK428DFHA82812HE0EKFP4ALIJKVXZVNGF26AFUU M 6I6MLI6CG24685KKAAA887OSUM6820066C2IKGII2KWMA 068330 0500 082 236II8 xxzzxsxyttyxyxtxxvxzrttusttrtsuttpsyqjlptppqstpmrrtppoonnmmxrolmmspnmhkkmrqquxutwurtxztpmaaEoKz0261        0KPEA283IC312803ISUD35A8EAAE6HJ8FA52AVF 65 253022025D68267 40LyxvvyvyyzynyxtqvxpktttqvyvvtvvvsslimsrrropnopqprpsrokmomkjhnrlmjmmltrgqostsvzzrolkitmV1GkYly73693686A833586 508060 3yunAIcbVI   0APKEC625NRPEA05820HIF6555338  2569200CEMF6 2EI86 38736DDA7364 ApxzzzxxvuyyzyvxyxyxvoxlcinvvvsfvvsmlsvqsniqqqpnprmprqppqorppmpppqqrrrkppvxyxzzsovzwrpmpDS8INZjCvfG SwmIYeKD622524468366ht9KrX2hjqypI555IC6ZyXC kURnuvhB2k10 07CA424 28466CCNRcQLKDCCJRTKEHNWZYXMMNPH2GMHME86CD94820CwzxzyxyxxxzxxxtuvxmyvvxtqnuqqvsjvzyzvtvysjiotywvsvrspsmoojlmmrmqtutpsvtvvvvywxysgDtfKmnX9AHhUMjh330tq7UytwqwH1  RE4Nd5pprBEgMixyqRD FC24789F5WIFNPWxtKC2002842 84IU3524QU4K47ISUFIJF74804bSE5DRtvZIRQXkuehl57ofGn4KHevkyzR9Q5625DX110Ib7DXH7FFUPH4pwxzvxzzxyxxyyxvtttyvqsvyvtvvvxxvxyvqstvspqvvqqoivsjnotvspoprjilpsmomswurqrsquuzzxtosrhaZHSEQX9CA55   4DKF45DQNCNffDEWtWepT0CmAyvwxv37KXVQH5IWekrtiikkjhjpwysvwy  2822652CCHH5DUI467DE2PRHB8CZjdILHG8408663288SE0 KyxxvyzzzvwxzyzzzxxzyvvxvuqnnqtuxxxvvssvvvvytvssqvzvtstrrmoporrvtmlpsrppnprrtwsojllptvyxrpwvrjS9vC6StPXeIxSvxW5602020382462205HKC2CFHCB41MPC1FLFKaNIKKEAI6 31o5y7GQMg00zMVWYpA84 2MZhkhXmrnnxs9  052S    XSqyyxxzxwzzvxzxxzzxvxxynqvvttsrtvwyvspssqpklpvstrqqqpopwjdjqsqrrnquwvurssvwywuzyzzxswunfQASOdhFOdpzzvyxxxtwyzxzzwtwzxusortzxrvtsvvttqpprrooqqvprtrruuursurloqttrprvwuwxssrbJqfjJ65hLUjdUUdYl1PoZZqXuXFrqhyhVORRKDAGKFKRKDFA866FYgphgmpputfULD61 9VzytrqtxvxyzwrtxwvwxvwxvursvtqrstuttrpqpqottromrsmprsrsrlmnttqsutsstzvywrqwRlH6PdWFBZUTtiRfUZiPUqDrQ917lRHe7NixhhVMBBBBBIIF5UgbI8430000000BBAccumRotationSmartControllerSmartControllerhttpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10ccEDYXERXDYYeBadcEeEEeEvhb  dEeE bch aeeDdD acEeE bch aeceDaDcETXceDaaEaDYCKEeEEeEvhb  CEeE bch aeeDCD KEeE bch aeKeDDKETXKeDEaDYKRBKPXBYCXBYCXYBpCXYBBCXAAYBBCXYBBEiDEiDEiDEiDssstssstuussttuEiDsstKSKFQZXEDYuuuuuuuuCXouuYCXouuYCXuYttttEDssttuuEDsEDstEDstusssssuuusuuuuuuuuCXAc3SEiDttuuYCX205282af282SZ282EN282A223A22222222EiDtuYssuutstsssttssstssussEiDssstssusMF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3812422book  Page 21  Wednesday October 12 2005  259 PMlocaKLmaxp nameV3ugpost prep8MF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3httpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10cc048DHLPTXdhjl4NORPQUVWXST7Avw s9bT9VJs0asUasUTksIsIQVsAVsA9y9YRPVJs09VVNNNyN0NkOk8sEUkQs099sA 011eYAf2NZKA7KPYddZc6PPy2ZZZZYYYAf2KA7KPddZcAKdAQCFFFFHFFFP55XF29294x000vvoR0FFFQ sg29296R2929224x0004x0004x000iiiivvvv222200000000T4FTT4FTppTisU99VQQVsAYVshgyVvFCyVv9VRYRY5U7YasULV4asUrmm9 rsIsIXVsAYsL69YR9VRWk8sssrTzTFCCFJC Cf9bR CwGVtRVjiVVCiSsIasUTTTTTVsAVsAVsAVsAVsA9bTN9999sss99999YR9YR9YR9YRVVYVJs0VJs0VJs0VJs0VJs0VsVs99VsVsVs9ssI9NNNNNNNNCCNNNNNN99999999RRRRRRUUvvvvvvvvbNNNNNNNNNNNN99RRvvNNNNNNNNNNCCNNNNNNNNNNNNNNNWW99999999vvvvvvvvVVJNNNNNejbsaa 0fSSSS99sVTWsrrSSSV5asU9IvRs4RRTKSSvQQQs9KUsv22U2U222rU2222w2x22z222w222222222222 22242H22I2I2 22B22L2C222222B22FFFAT5Oiivv92KAXUfhsUs9aTass92AC242 22T2ATTnnn2AEkFF232A82A0 00Po0zpwwz222222sOst2o2p222A22A02d322222At558P5tAX7 7000   7  A7 07AtttttptttttOztuwpppppzpppptpupwztuwPPPPPzPPPPtPuPwztuw00000z0000t0u0w     z    t u wztuwztuwAztuw0ttztuwztuwztuwztuw     z    t u wXxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype140xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype110xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAICoolBreezexmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetype40xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype12xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypedilatexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeaxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype12xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypedilatexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypebxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypebxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetypebxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeb1xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeb1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypeb1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype02xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetypeb2xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeb2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype3xmlnodenodevaluescalexmlnodenodenamescalexmlnodeattributesxmlnodechildrenxmlnodenodetypeb2xmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeb1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeb3xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeb3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeAxmlnodenodevalueyChannelSelectorxmlnodenodenameyChannelSelectorxmlnodeattributesxmlnodechildrenxmlnodenodetypeRxmlnodenodevaluexChannelSelectorxmlnodenodenamexChannelSelectorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDisplacementMapxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypematrixxmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype0 0 0 0 0  0 0 0 0 0  0 0 0 1 0  0 0 0 1 0xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypeb3xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeb4xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeb4xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeColorMatrixxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeb4xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeb5xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeb5xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypefreezexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypestdDeviationxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluefromxmlnodenodenamefromxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluetoxmlnodenodenametoxmlnodeattributesxmlnodechildrenxmlnodenodetype5sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetypebxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype005xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluescalexmlnodenodenamescalexmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypec3xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypeAxmlnodenodevalueyChannelSelectorxmlnodenodenameyChannelSelectorxmlnodeattributesxmlnodechildrenxmlnodenodetypeRxmlnodenodevaluexChannelSelectorxmlnodenodenamexChannelSelectorxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDisplacementMapxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypematrixxmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype0 0 0 0 0  0 0 0 1 0  0 0 0 1 0  0 0 0 1 0xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypec3xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypec4xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec4xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeColorMatrixxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypec4xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypec5xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec5xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypec5xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeb5xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIDilate3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype3xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypedilatexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIDilate6xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype6xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypedilatexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIErode3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype3xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypeerodexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIErode6xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype6xmlnodenodevalueradiusxmlnodenodenameradiusxmlnodeattributesxmlnodechildrenxmlnodenodetypeerodexmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMorphologyxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIGaussianBlur4xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeAIGaussianBlur7xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype7xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype50 50xmlnodenodevaluefilterResxmlnodenodenamefilterResxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIPixelPlay1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypefilterResxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypesplinexmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetype10sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetype1 120 15200 200 15 201 1 xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype7xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypecompositeOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypecompositeOutxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypecompositeOut1xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypecompositeOut1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype50 50xmlnodenodevaluefilterResxmlnodenodenamefilterResxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIPixelPlay2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypefilterResxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetype10sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetype50 5020 2050 50xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype7xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluediffuseConstantxmlnodenodenamediffuseConstantxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevalueresultScalexmlnodenodenameresultScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeyellowxmlnodenodevaluelightingcolorxmlnodenodenamelightingcolorxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypelightingcolorxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetype15sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetypeyellowgreenblueindigovioletredorangexmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype60xmlnodenodevalueelevationxmlnodenodenameelevationxmlnodeattributesxmlnodechildrenxmlnodenodetype180xmlnodenodevalueazimuthxmlnodenodenameazimuthxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDistantLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDiffuseLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetyperedxmlnodenodevaluelightingcolorxmlnodenodenamelightingcolorxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluespecularConstantxmlnodenodenamespecularConstantxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevaluespecularExponentxmlnodenodenamespecularExponentxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypelightingcolorxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetype0sxmlnodenodevaluebeginxmlnodenodenamebeginxmlnodeattributesxmlnodechildrenxmlnodenodetype15sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetypeindigogreenyellowbluevioletredorangexmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype60xmlnodenodevalueelevationxmlnodenodenameelevationxmlnodeattributesxmlnodechildrenxmlnodenodetype180xmlnodenodevalueazimuthxmlnodenodenameazimuthxmlnodeattributesxmlnodechildrenxmlnodenodetypelightxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDistantLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeSpecularLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaint1xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaint1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIShadow1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype2xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype130xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype140xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIShadow2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype6xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildren3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroupAIPatternEditorTileWidthAIPatternEditorPreviewColsAIPatternEditorDimCopiesKeyAIPatternEditorLeftinFrontAIPatternEditorTopinFrontAIPatternEditorTileHeightAIPatternEditorPreviewRowsAIPatternEditorDimPercentKeyAIPatternEditorEditableCopyLocKeyNew Pattern 11New Pattern 4Unnamed 6Unnamed Brush Pat 1xmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIAlpha1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbulencexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype005xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetype2xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIAlpha4xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype01xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype140xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype140xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIBevelShadow1xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetype20xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetype20xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypelightingcolorwhitexmlnodenodevaluestylexmlnodenodenamestylexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluespecularConstantxmlnodenodenamespecularConstantxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluespecularExponentxmlnodenodenamespecularExponentxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype20000xmlnodenodevaluezxmlnodenodenamezxmlnodeattributesxmlnodechildrenxmlnodenodetype10000xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetype5000xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefePointLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeSpecularLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypespecOutxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypespecOutxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueinxmlnodenodenameinxmlnodeattributes1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroupCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35AIPatternIsRepeatedArtAIPatternEditorAutoSpacingVAIPatternEditorAutoGrowAIPatternEditorAutoSpacingHAIPatternEditorTileWidthAIPatternEditorPreviewColsAIPatternEditorDimCopiesKeyAIPatternEditorLeftinFrontAIPatternEditorTopinFrontAIPatternEditorTileHeightAIPatternEditorPreviewRowsAIPatternEditorRepetitionTypeAIPatternEditorDimPercentKeyAIPatternEditorEditableCopyLocKeyPompadourPompadourAIPatternEditorBackingTileRect1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationAIPatternIsRepeatedArtAIPatternIsMainCopyofEditGroup1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation1837222BBAccumRotation3141592BBAccumRotation3141592BBAccumRotation3141592BBAccumRotationUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83AIPatternIsRepeatedArtUnnamed gradient 353141593BBAccumRotationCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35AIPatternIsRepeatedArtUnnamed gradient 353141593BBAccumRotationCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 353141593BBAccumRotationCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 83Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 35CAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Unnamed gradient 353141593BBAccumRotationCAIGradientTformMatrixAdobeAI9ArtStyleDictionaryUnnamed gradient 35Adobe Vectorized ObjectImage TracingVectorizeaipAdobe Flare PluginFlareflareaipAdobe Deform PluginAdobe Envelope PluginEnvelope and WarpaipAdobe Planar GroupAdobe Live Paint PluginLive PaintaipAdobe Perspective Plugin GroupAdobe Perspective Plugin GroupPerspectiveaipAdobe Path BlendsAdobe Blends PluginLive BlendsaipAdobe SymbolismAdobe SymbolismSymbolismaipAdobe PatternOnPath Brush ToolAdobe Pattern Brush PluginArtOnPathaipAdobe PatternOnPath Brush ToolAdobe Pattern Brush PluginArtOnPathaipAdobe ArtOnPath Brush ToolAdobe Art Brush PluginArtOnPathaipAdobe ArtOnPath Brush ToolAdobe Art Brush PluginArtOnPathaipAdobe Calligraphic Brush ToolAdobe Calligraphic Brush PluginCalligraphic Brush ToolaipAdobe Scatter Brush ToolAdobe Scatter Brush PluginScatter Brush ToolaipAdobe Scatter Brush ToolAdobe Scatter Brush PluginScatter Brush ToolaipAdobe Pattern Editor Plugin GroupAdobe Pattern Editor Plugin GroupSwatch LibrariesaipPathfinder SuiteAdobe Compound ShapePathFinder SuiteaipFading SkyFading SkyOrange YellowOrange YellowSuper Soft Black VignetteSuper Soft Black VignetteUnnamed gradient 1Unnamed gradient 1Unnamed gradient 10Unnamed gradient 10Unnamed gradient 14Unnamed gradient 14Unnamed gradient 16Unnamed gradient 16Unnamed gradient 18Unnamed gradient 18Unnamed gradient 19Unnamed gradient 19Unnamed gradient 21Unnamed gradient 21Unnamed gradient 35Unnamed gradient 35Unnamed gradient 4Unnamed gradient 4Unnamed gradient 41Unnamed gradient 41Unnamed gradient 42Unnamed gradient 42Unnamed gradient 5Unnamed gradient 5Unnamed gradient 51Unnamed gradient 51Unnamed gradient 54Unnamed gradient 54Unnamed gradient 8Unnamed gradient 8Unnamed gradient 83Unnamed gradient 83White BlackWhite BlackFoliageFoliagedTVb04S34Q2BosBheDheDheDRht35Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SCC0dS5Gl4O0HaRB0J50J5ibW5Gl1EkFht35CdTVb04S34Q2Bos0etUiipdTb31CC0dS5Gl4O0HaRBhoEECC0dq5CdTVb04S34Q2Bos0etUiipdTb3dTG4s3Qht34O0HaRB0fC5CC0dS5Gl4O0HaRB0J50J50J5pdTP4s3Qht34O0HaRB0fC6CC0dS5Gl4O0HaRB0J50J5ibW5Gl1atGht35CdTVb04S34Q2BosBheDheD20I04Sht35CdTVb04S34Q2BosBheDheD20I5CdTVb04S34Q2Bos0etUiibW5Gl1atGht35C3LfVb04SibdTVb04S34Q2Bos1U11U11U15Gl0dYDht35C20I04Sht35C20I04Sht35Cht35CdTVb0M24Q2BosBheD2MCC0d7p5CdTVb0M24Q2BosBheD2MCC0d7p5CdTVb0M24Q2BosBheD2MCC0d7p5C20I04Sht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheDheDheDRht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0dS5Dk9GOQ1U11U120I04Sht35CdTVb04S34Q2BosBheD2MCC0d7p5CdTG4s3Qht34O0HaRB1apdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2Bos0etUiipdTb3ht35CdTG4s3Qht34O0HaRB2updTVb0M24Q2BosBheD1U11U15Gl0dYDht35CdTG4s3Qht34O0HaRB2epdTVb0M24Q2Bos1U11U11U15Gl0dYDht35CEK5Gl4O0HJ5Dk9GOR2M2M20I04Sht35CdTG4s3Qht34O0HaRB2VCC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2VCC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2VCC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V0CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V1CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V2CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V3CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht3pht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SpdTVb04S34Q2BosBheDheDheDRht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0dS5Dk9GUP0H0HuCC0dq5CdTb3dTG4s3Qht34O0HaRB3U7pdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheDheDRht35C20I04Sht35CdTVb04S34Q2Bos0etUiipdTb31CC0dS5Gl4O0HaRBhoEECC0dq5CdTVb04S34Q2BosBheD1U11U15Gl0dYDht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheD20I04Sht35C2M2MCC0dq5CR7hjSkL8K1DRWVSdTTA6dPkCK50Xk74Q2ok0dS5Dk9Hj5DkM8n0Xurr3LfVb0MibbRk4s2sM5DkM8n0Xurr4dTVb0M24Q2BosBheD2MCC0d7p5CdTY4s3Qht34O0HaRB1AqpdTVb0M24Q2BosBheD2MCC0d7p5C20I04Sht35CdTP4s3Qht34O0HaRB1APpdTVb0M24Q2BosBheD2MCC0d7p5C20I04Sht35CdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J50J50J5pdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CZ5Gl4O0HJ5Dk9GUP0HuMopdTY4s3Qht34O0HaRB1A0CC0dS5Dk4O0HaRB0J5ib20I04Sht35C20I04Sht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheDheDheDRht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0dS5Dk9GOQ1U11U120I04Sht35CdTVb04S34Q2BosBheD2MCC0d7p5CdTG4s3Qht34O0HaRB1apdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2Bos0etUiipdTb3ht35CdTG4s3Qht34O0HaRB2updTVb0M24Q2BosBheD1U11U15Gl0dYDht35CdTG4s3Qht34O0HaRB2epdTVb0M24Q2Bos1U11U11U15Gl0dYDht35CEK5Gl4O0HJ5Dk9GOR2M2M20I04Sht35CdTG4s3Qht34O0HaRB2VCC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2VCC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2VCC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V0CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V1CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V2CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht34O0HaRB2V3CC0dS5Dk4O0HaRB0J5iipdTG4s3Qht3pht35CEK5Gl4O0HJ5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheD2MCC0d7p5Cht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0dS5Dk9GUP0H0HuCC0dq5C0dC4O0HaRB0ejeCC0dS5Gl4O0HaRB0J5iipdTG4s3Qht34O0HaRB0eje0CC0dS5Gl4O0HaRB0J50J50J5pdTP4s3Qht34O0HaRB0eje20I04S34Q3Vb0MQEEECC0dq5CdTVb04S34Q2BosBheDheDheDRht35Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheDheDheDRht35Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheD1U11U15Gl0dYDht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheD20I04Sht35C1BjF04S34Q3Vb0MQB2M2MCC0dq5CdTVb04S34Q2Bos0etUiipdTb3EK5Gl4O0HJ5Dk9GUP0H0H0HaXD04SdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J5ib20I04Sht35CdTY4s3Qht34O0HaRB1A1CC0dS5Dk4O0HaRBib2MCR4s3Qht3pdTG4s3Qht34O0HaRB1EVpdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheDheDRht35CdTVb0M24Q2BosBheD1U11U15Gl0dYDht35Cht35Cht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SpdTVb04S34Q2BosBheDheDheDRht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0dS5Dk9GUP0H0HuCC0dq5CdTb3dTG4s3Qht34O0HaRB3U7pdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheDheDRht35C20I04Sht35CdTVb04S34Q2Bos0etUiipdTb31CC0dS5Gl4O0HaRBhoEECC0dq5CdTVb04S34Q2BosBheD1U11U15Gl0dYDht35CdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheD20I04Sht35C2M2MCC0dq5C20I5C2MCR4s3Qht3p4s4R5C0ZUm5CheD0eaheD0eje5HHII2DH5Wok2DZI1heD2DcO5heD2DlU2heD2DuCC2EHII2djLr5Z4EVXHAKWWb3FBosCheDheDheDheDRht35CdUVb0YSGKEEGKto25Gl9Hj5Dks5HSEd0dnDrrcht34O0HeCrrKW5Gls5H2CTb44s2sM5Dks5Hq6uM0dnDrrht34O0HeCrubPq3L8uR6hZ2J5C1Gg00XkR6hmR0Xurr4bR1a4Gru1ht34O0Ho04Rtrr2u3L9R6h4s0Frr4bRk4s2sM5Dk2PR6hDsS0Xurr41a4GruaOht34O0Hs04Rtrr41ER6hDsS0Xurr40dR6hDsS0Xurr41aGR6hDsS0Xurr42BXYR6h2gQ0Xurr4R6h37Ok0Xurr2u13L9R6hDQ0Oerr2s3LfVb0M1A5m04SRGKEEECR4s3Q5T1EVXHAKWW3WEaFBosCheDheDheDheDRht35CHsdY3L9p4s3Qht34O0HJ586DerBuEMLWDKIS0HJ5Dks5H9TGEWBeRsgHAZKDZFVSt0o5Jm0HPCht35CheD0eaheD0eje5HHII20ta11G10td2AmoLsAKWWc2Rq0tj44O3B838es04Rtrr2sP3LfVb0Lsrr4G4HAm0dnDrroht34O0HeCrrM5Gls5H29Y34s2sM5Dks6BD0dnDrrcht34O0HeCrrBM5Gls5H1FXG14s4R5C5MniUE5Poi5SpiUE5Vqi5YriOn3Fl4s2sM5Dk1A5bR1a4Gru1ht34O0H1p04Rtrr4bRk4s2sM5Dk2BXYR6h37Ok0Xurr2u13L9R6hkn0Oerr43LfVb0M5Gls5h1AEru25Mns5hbR1a4Gru1ht34O0Ht04Rtrr2u3L9R6h4s0Frr4l4s2sM5Dk0fq0dnDru25Jms5hWa1EFru15Pos5hl4s2sM5Dk0f10dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk0f0dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk0fC0dnDru25Jms5hWa1EFru15Pos5hl4s2sM5Dk0fU0dnDrrBbRk4s2sM5Dk1C0dnDru35Jms5hWa1EFru5Pos5hl4s2sM5Dk1U10dnDrrBl4s2sM5Dk1I10dnDsGHB5Jms6r3q4s2sM5Dk1GBql4s2sM5Dk0eje0dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk0fL40dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk0f00dnDrrB0dnDru35Jms5h1EFru45Pos5hbRk4s2sM5Dk10nbRk4s2sM5Dk1L0dnDru35Jms5hWa1EFru45Pos5hl4s2sM5Dk170dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk1g0dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk1GL0dnDru35Jms5h1EFru5Pos5hl4s2sM5Dk1GU0dnDru15Jms5hWa1EFru5Pos5hl4s2sM5Dk1G0dnDru35Jms5h1EFru45Pos5hbRk4s2sM5Dk1Gg40dnDrrBl4s2sM5Dk1H0dnDru35Jms5h1EFru45Pos5hbRk4s2sM5Dk1HF00dnDrrBbRk4s2sM5Dk1HR20dnDrrBHII1hLr5KHII19taLr5KDuFHII1LcLr5KDuFHII17eLr5KDuFHII1pCgLr5K1DuFHII1GBq5NDuFHII1GUbLr5NDuFHII1Gg4dLr5NFul1H0heD1HF35N1ok1HR35QDuFHII1bg5Qok1c74Q2Mo5CHII2BosCheDheDheDheDRht35CBosCheDheDheDheDRht35CheD1EA0HE5Sp0J50aq5Yr0eP40t5tFE2M85Htq0eje5H1bUA3E2C2C0eb1bUA7PHMT1C0JG12DgC3AF6SL2P2C2C0eb1bUA7PHMT1C6SL2L0JG17PHMT1C0JG12ZpD3E2C0JG12ZpD3E2pCias6UHE6uR9eFpp7CoVdh4MWVdL6Is9IATCgEbZiFCias6UH6Vd6ZRa8SqmKATLgh7WMpSATJu9Eckq6UH6Vd73EeEObFE296fCias6UH6Vd8TSFYDfBlBl8DJIdWVARnVXDeATJuLr144VdL03Cias6UH6Vd6FLnEc5nkGdfVdLWA7SMFB4XYPAoAfLr144VdL00sZIsK8GdfVdLWDILA7WEOBl7DuFGdfVdLWDILA7MFCfKruFAKYSnCias6UH6Vd8TSFWlFQJVC1UmsemBl7RCh6OVCh7uDfQsRfrVdLW6sGKH4sAThctAISt AI12 Job Options DataAI12 Job Options SizeAdobe PDF PresetjoboptionsAI12 Job Options NameAISaveMultipleArtboardsAISaveMultipleArtboardsAllSelectedMXGHsdY3L9p4s3Qht3p9Y0d1n5C4s2sM5Dks6SM6T5Gl1EkFVb0Lsrr4D0V0904Sht34O0HeCsLTd0d7p5C4s2sM5Dks6Vep5Gl1EkFVb0Lsrr4M0WB04Sht34O0HeCsLEW8rC0d7p5CE4s2sM5Dks5hd55Gl3CKVb0Lsrr40HPCVb0Lsrr2tm2nb04S0HPCVb0Lsrr2u3dmp04S0HPCVb0Lsrr40HPCVb0Lsrr43LfVb04SibdTVb04S34Q2Bos1U11U11U15Gl0dYDht35CdTP4s3Qht34O0HaRB1APpdTVb0M24Q2BosBheDheDheDR5Gl1EkFht35CdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J50J50J5pdTY4s3Qht34O0HaRB1ACC0dS5Dk4O0HaRB0J50J5ibW5Gl1EkFht35CdTVb0M24Q2BosBheDheD20I04Sht35CdTY4s3Qht34O0HaRB1A0CC0dS5Dk4O0HaRB0J50J5ibW5Gl1EkFht35CdTG4s3Qht34O0HaRB1EVpdTVb04S34Q2BosBheDheDheDR5Gl1AbEht35CdTVb04S34Q2BosBheDheDheDRht35CdTG4s3Qht34O0HaRB2XspdTVb0M24Q2Bos1U11U11U15Gl0dYDht35Cht35C20I04Sht35CdTG4s3Qht34O0HaRB2kpdTVb0M24Q2BosBheD1U11U15Gl0dYDht35Cht35Cht35Cht35Cht35Cht35Cht35CZ5Gl4O0HJ5Dk9GUP0Hu2M20I04Sht35Cht35CdTVb0M24Q2BosBheDheD20I04Sht35CEK5Gl4O0HJ5Dk9GUP0H0H0HaXD04SZ5Gl4O0HJ5Dk9GUP0H0HuCC0dq5CdTb3EK5Gl4O0HJ5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheDheD20I04Sht35CEK5Gl4O0dS5Dk9GUP0H0H0HaXD04SdTVb04S34Q2BosBheDheDheDRht35CdTVb04S34Q2BosBheDheDheDRht35CZ5Gl4O0dS5Dk9GUP0H0HuCC0dq5CdTb3mpdTVb04S34Q2BosBheDheD20I04Sht35CxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIStaticxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypec1xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype05xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetyperemovexmlnodenodevaluefillxmlnodenodenamefillxmlnodeattributesxmlnodechildrenxmlnodenodetypeindefinitexmlnodenodevaluerepeatDurxmlnodenodenamerepeatDurxmlnodeattributesxmlnodechildrenxmlnodenodetypebaseFrequencyxmlnodenodevalueattributeNamexmlnodenodenameattributeNamexmlnodeattributesxmlnodechildrenxmlnodenodetypelinearxmlnodenodevaluecalcModexmlnodenodenamecalcModexmlnodeattributesxmlnodechildrenxmlnodenodetypenonexmlnodenodevalueaccumulatexmlnodenodenameaccumulatexmlnodeattributesxmlnodechildrenxmlnodenodetypereplacexmlnodenodevalueadditivexmlnodenodenameadditivexmlnodeattributesxmlnodechildrenxmlnodenodetype05xmlnodenodevaluefromxmlnodenodenamefromxmlnodeattributesxmlnodechildrenxmlnodenodetype07xmlnodenodevaluetoxmlnodenodenametoxmlnodeattributesxmlnodechildrenxmlnodenodetype5sxmlnodenodevaluedurxmlnodenodenamedurxmlnodeattributesxmlnodechildrenxmlnodenodetypealwaysxmlnodenodevaluerestartxmlnodenodenamerestartxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevalueanimatexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypec2xmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAITurbulence3xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbulencexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype005xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetype8xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype100xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAITurbulence5xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype04xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeturbxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype150xmlnodenodevalueheightxmlnodenodenameheightxmlnodeattributesxmlnodechildrenxmlnodenodetype150xmlnodenodevaluewidthxmlnodenodenamewidthxmlnodeattributesxmlnodechildrenxmlnodenodetypeobjectBoundingBoxxmlnodenodevaluefilterUnitsxmlnodenodenamefilterUnitsxmlnodeattributesxmlnodechildrenxmlnodenodetypeAIWoodgrainxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevalueyxmlnodenodenameyxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluexxmlnodenodenamexxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypefloodcolorblack floodopacity04xmlnodenodevaluestylexmlnodenodenamestylexmlnodeattributesxmlnodechildrenxmlnodenodetypecolorxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypecolorxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeFloodxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypecolorxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypeshadowColorxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluediffuseConstantxmlnodenodenamediffuseConstantxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevalueresultScalexmlnodenodenameresultScalexmlnodeattributesxmlnodechildrenxmlnodenodetypewhitexmlnodenodevaluelightingcolorxmlnodenodenamelightingcolorxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype60xmlnodenodevalueelevationxmlnodenodenameelevationxmlnodeattributesxmlnodechildrenxmlnodenodetype135xmlnodenodevalueazimuthxmlnodenodenameazimuthxmlnodeattributesxmlnodechildrenxmlnodenodetypelight2xmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDistantLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDiffuseLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypewhitexmlnodenodevaluelightingcolorxmlnodenodenamelightingcolorxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluesurfaceScalexmlnodenodenamesurfaceScalexmlnodeattributesxmlnodechildrenxmlnodenodetypeblurxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluespecularConstantxmlnodenodenamespecularConstantxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluespecularExponentxmlnodenodenamespecularExponentxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetype60xmlnodenodevalueelevationxmlnodenodenameelevationxmlnodeattributesxmlnodechildrenxmlnodenodetype135xmlnodenodevalueazimuthxmlnodenodenameazimuthxmlnodeattributesxmlnodechildrenxmlnodenodetypelightxmlnodenodevalueidxmlnodenodenameidxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeDistantLightxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeSpecularLightingxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypediffusexmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek4xmlnodenodenamek4xmlnodeattributesxmlnodechildrenxmlnodenodetype0xmlnodenodevaluek1xmlnodenodenamek1xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek3xmlnodenodenamek3xmlnodeattributesxmlnodechildrenxmlnodenodetype1xmlnodenodevaluek2xmlnodenodenamek2xmlnodeattributesxmlnodechildrenxmlnodenodetypearithmeticxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypespecularOutxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeoffsetBlurredAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypelitPaintxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypefractalNoisexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype05xmlnodenodevaluebaseFrequencyxmlnodenodenamebaseFrequencyxmlnodeattributesxmlnodechildrenxmlnodenodetype10xmlnodenodevaluenumOctavesxmlnodenodenamenumOctavesxmlnodeattributesxmlnodechildrenxmlnodenodetypenoStitchxmlnodenodevaluestitchTilesxmlnodenodenamestitchTilesxmlnodeattributesxmlnodechildrenxmlnodenodetypeTurbulencexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeTurbulencexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypematrixxmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype1 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 1xmlnodenodevaluevaluesxmlnodenodenamevaluesxmlnodeattributesxmlnodechildrenxmlnodenodetypeTurbulencexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeGrayscalexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeColorMatrixxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetype4xmlnodenodevaluedxxmlnodenodenamedxxmlnodeattributesxmlnodechildrenxmlnodenodetype5xmlnodenodevaluedyxmlnodenodenamedyxmlnodeattributesxmlnodechildrenxmlnodenodetypeBlurredAlphaxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeOffsetBlurredAlphaxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeOffsetxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeOffsetBlurredAlphaxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeGrayscalexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompBlurTurbxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeCompBlurTurbxmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetype15xmlnodenodevaluestdDeviationxmlnodenodenamestdDeviationxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompBlurTurb2xmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeGaussianBlurxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeGrayscalexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompXferFirexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypetablexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype2 0xmlnodenodevaluetableValuesxmlnodenodenametableValuesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeFuncRxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypetablexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype7 0 xmlnodenodevaluetableValuesxmlnodenodenametableValuesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeFuncGxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypetablexmlnodenodevaluetypexmlnodenodenametypexmlnodeattributesxmlnodechildrenxmlnodenodetype1 0xmlnodenodevaluetableValuesxmlnodenodenametableValuesxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeFuncBxmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeComponentTransferxmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeinxmlnodenodevalueoperatorxmlnodenodenameoperatorxmlnodeattributesxmlnodechildrenxmlnodenodetypeSourceGraphicxmlnodenodevaluein2xmlnodenodenamein2xmlnodeattributesxmlnodechildrenxmlnodenodetypeCompXferFirexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompSourceFirexmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeCompositexmlnodenodenamexmlnodeattributesxmlnodechildrenxmlnodenodetypeMergeAllxmlnodenodevalueresultxmlnodenodenameresultxmlnodeattributesxmlnodeattributesxmlnodechildrenxmlnodenodetypeCompSourceFirexmlnodenodevalueinxmlnodenodenameinxmlnodeattributesxmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergeNodexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefeMergexmlnodenodenamexmlnodechildrenxmlnodenodetypexmlnodenodevaluefilterxmlnodenodenameGerberaIlluminated OrangeUnnamed gradient 42Unnamed gradient 10wwwraymarinecom3KDKD43441444ttt048DHLPTXdhjl4NORPQUVWXST7Avw s9bT9VJs0asUasUTksIsIQVsAVsA9y9YRPVJs09VVNNNyN0NkOk8sEUkQs099sA 011eYAf2NZKA7KPYddZc6PPy2ZZZZYYYAf2KA7KPddZcAKdAQCFFFFHFFFP55XF29294x000vvoR0FFFQ sg29296R2929224x0004x0004x000iiiivvvv222200000000T4FTT4FTppTisU99VQQVsAYVshgyVvFCyVv9VRYRY5U7YasULV4asUrmm9 rsIsIXVsAYsL69YR9VRWk8sssrTzTFCCFJC Cf9bR CwGVtRVjiVVCiSsIasUTTTTTVsAVsAVsAVsAVsA9bTN9999sss99999YR9YR9YR9YRVVYVJs0VJs0VJs0VJs0VJs0VsVs99VsVsVs9ssI9NNNNNNNNCCNNNNNN99999999RRRRRRUUvvvvvvvvbNNNNNNNNNNNN99RRvvNNNNNNNNNNCCNNNNNNNNNNNNNNNWW99999999vvvvvvvvVVJNNNNNejbsaa 0fSSSS99sVTWsrrSSSV5asU9IvRs4RRTKSSvQQQs9KUsv22U2U222rU2222w2x22z222w222222222222 22242H22I2I2 22B22L2C222222B22FFFAT5Oiivv92KAXUfhsUs9aTass92AC242 22T2ATTnnn2AEkFF232A82A0 00Po0zpwwz222222sOst2o2p222A22A02d322222At558P5tAX7 7000   7  A7 07AtttttptttttOztuwpppppzpppptpupwztuwPPPPPzPPPPtPuPwztuw00000z0000t0u0w     z    t u wztuwztuwAztuw0ttztuwztuwztuwztuw     z    t u wXhttpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10ccEDYXERXDYYeBadcEeEEeEvhb  dEeE bch aeeDdD acEeE bch aeceDaDcETXceDaaEaDYCKEeEEeEvhb  CEeE bch aeeDCD KEeE bch aeKeDDKETXKeDEaDYKRBKPXBYCXBYCXYBpCXYBBCXAAYBBCXYBBEiDEiDEiDEiDssstssstuussttuEiDsstKSKFQZXEDYuuuuuuuuCXouuYCXouuYCXuYttttEDssttuuEDsEDstEDstusssssuuusuuuuuuuuCXAc3SEiDttuuYCX205282af282SZ282EN282A223A22222222EiDtuYssuutstsssttssstssussEiDssstssusMF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3812422book  Page 21  Wednesday October 12 2005  259 PMlocaKLmaxp nameV3ugpost prep8MF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3httpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10cchttpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10ccEDYXERXDYYeBadcEeEEeEvhb  dEeE bch aeeDdD acEeE bch aeceDaDcETXceDaaEaDYCKEeEEeEvhb  CEeE bch aeeDCD KEeE bch aeKeDDKETXKeDEaDYKRBKPXBYCXBYCXYBpCXYBBCXAAYBBCXYBBEiDEiDEiDEiDssstssstuussttuEiDsstKSKFQZXEDYuuuuuuuuCXouuYCXouuYCXuYttttEDssttuuEDsEDstEDstusssssuuusuuuuuuuuCXAc3SEiDttuuYCX205282af282SZ282EN282A223A22222222EiDtuYssuutstsssttssstssussEiDssstssusMF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3812422book  Page 21  Wednesday October 12 2005  259 PMlocaKLmaxp nameV3ugpost prep8MF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3httpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10ccRaymarine SmartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarine SmartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarine SmartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarine SmartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarine SmartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarine SmartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarin SmartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinSmartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinmartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinartController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinrtController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarintController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinController812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinontroller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinntroller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarintroller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinroller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinoller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinoller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinoller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinoller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinoller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinoller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinoller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinller812433book  Page 44  Wednesday March 29 2006  404 PMRaymarinler812433book  Page 44  Wednesday March 29 2006  404 PMRaymarin812433book  Page 44  Wednesday March 29 2006  404 PMRaymarin812433book  Page 44  Wednesday March 29 2006  404 PMRaymarin812433book  Page 44  Wednesday March 29 2006  404 PMRaymari812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PMSmartController812422book  Page 21  Wednesday October 12 2005  259 PMUser GuideGetting StartedHow do I power the unit onoff 7Keylock 7Using your SmartControllerHow do I view instrument data 9How do I see all the available data 10How do I use the autopilot 11How do I automatically steer straight 12How do I follow a route  from my GPS 13How do I follow a circle pattern 14How do I follow a zigzag pattern 15How do I follow a cloverleaf pattern 16How do I steer to a fixed wind angle 17How do  I tack using the autopilot 18How do I dodge an obstacle 19Setting up your SmartControllerHow do I change a favourite page 21How do I change the page layout 22How do I change page content 23How do I show or hide pages 24How do I change the pattern direction 25How do I change my boat type  26How do I adjust the handset settings27Alarms and TroubleshootingHow do I set up alarms 29SmartController Alarm messages 31Fault finding 33General maintenance 34Product Support 37Important Safety InformationIntended Use 42Declaration of Conformity 42EMC Guidelines 42Handbook Information 43812433book  Page 3  Wednesday March 29 2006  404 PMRaymarine SmartController    started   812433book  Page 4  Wednesday March 29 2006  404 PMUser GuideBattery power and signal strengthThe battery power 5 levelsindicated on the left hand side of the display Your SmartController will sound an alarm when battery power is running lowWireless signal strength is shown similarly on the right hand side of the displayCharging the SmartControllerBefore using the SmartController for the first time you will need to charge the unit To charge the SmartController simply place it into the cradle pull open the rubber cover on the base  and connect the charging cable CAUTION  Do not use any other cable to charge the unitThe battery power indicator will flash during charging The recommended charge time is approximately five hours Once fully charged the battery indicator will stop flashingThe SmartController can also be charged whenever you wish without affecting performance812433book  Page 5  Wednesday March 29 2006  404 PMRaymarine SmartControllerYour SmartControllerPILOT  Use to activate the autopilotExit cancel or back When off press to power on the ACTION Performs softkey functionset of valuesNAVIGATE STARBOARDUse in PILOT mode to power steer your boat Press and hold for Smart SteerSTANDBY  control of your boat when in PILOT modemodeNAVIGATE PORT Use in PILOT modeto power steer your boat Press and812433book  Page 6  Wednesday March 29 2006  404 PMUser GuideHow do I power the unit onoffPower onPress and hold the button The handset will beep the display will show the first instrument data page and you222re ready to goPower offPress and hold the  button for 3 seconds The display will countdown to zero and will then go blank Note  You cannot power off the handset when the autopilot is in control of your boatKeylockWhen using your SmartController you can temporarily lock the autopilot keys to ensure that it is not accidentally operated Access to the instrument pages is unaffected by the keylockHow do I activate the keylockPress and hold the mode button until you see the 223KEYLOCK ACTIVE224 message A key symbol will also be displayed on the instrument data pagesNote  You cannot activate keylock when the autopilot is in control of your boatHow do I turn off the keylockmode followed by unlock A 223KEYLOCK OFF224 message will be displayed812433book  Page 7  Wednesday March 29 2006  404 PMRaymarine SmartControllerSmartController812433book  Page 8  Wednesday March 29 2006  404 PMUser GuideYour SmartController can display up to 8 pages of boat information Each page can be set to show 12 or 4 data items or to view information graphically When the autopilot is enabled an extra P page is added to the favourites showing autopilot specific informationFrom the main instrument display1 Press the  key to page2 The number of the page hand corner3 Press the softkey to Example Screens             47FT           11KTSXTE       035NMBTWDTWIf you only ever use a few favourite pages usethe PAGE ONOFF feature to turn off the rest812433book  Page 9  Wednesday March 29 2006  404 PMRaymarine SmartControllerHow do I see all the available dataYou can display all the available SeaTalk data in a list for reference This is particularly useful when checking the availability of data or SHOW ALL DATA                ALL DATADEPTH   47  FTSPEED            11 KTSSOG              97  KTSVMG W    KTSBACKWhen planning your favourite pages use SHOWALL DATA to see what data will be shownFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toSHOW ALL DATA and press the SELECT softkey3 All of the available SeaTalk data present value Use the updown key to scroll through the data Where the is no data present Example Screen812433book  Page 10  Wednesday March 29 2006  404 PMUser GuideYou can change your boat type in the autopilotYour autopilot can steer your boat according to one of its preset modes The modes that are available are dependant on your boat and autopilot type Each of these are explained on the following pagesAvailable modesPOWERFISHINGSAILAUTOAUTOAUTOZIGZAGCLOVERTRACKTRACKTRACKTACK812433book  Page 11  Wednesday March 29 2006  404 PMRaymarine SmartControllerHow do I automatically steer straightFrom any screen1 Steer your boat onto the desired 2 Check that there are no obstructions 3 Press the PILOT key to activate PILOTActivates autopilot inAUTO modeSTANDBYTo continue on your current heading under autopilot control use the AUTO mode This will steer you in a straight line ahead until commanded otherwise AUTO mode can be used in conjunction with SMARTSTEER to give you remote powersteering control of your boatAUTO mode is also available for selection viaAUTO812433book  Page 12  Wednesday March 29 2006  404 PMUser GuideHow do I follow a route from my GPSTRACKactivates autopilotin TRACK modeyou reach TRACKPress when asked toPILOTPILOTPress when asked toYour autopilot can follow a route that you have previously set on your GPS or Chartplotter Ensure that your GPSChartplotter is sending valid SeaTalk or NMEA 0183 dataFrom any screenTRACK is displayedPILOT to activate TRACK mode3 If a valid route is received the it will steer to Press PILOT Note  At each waypoint required Press PILOT PILOT812433book  Page 13  Wednesday March 29 2006  404 PMRaymarine SmartControllerHow do I follow a circle patternWhen you select CIRCLE mode your current position is marked as the center of the circle pattern Your autopilot will now gently steer your boat into the circle of the selected sizeFrom any screen2 Use the STARBOARD keys to change the size S M or L3 Press the PILOT key to activate Sml Med or Largeactivates autopilotPILOTIf your circles are gradually becoming larger increase812433book  Page 14  Wednesday March 29 2006  404 PMUser GuideZIGZAGFrom any screenZIGZAG is displayed2 Use the STARBOARD keys to change the size S M or L3 Press the PILOT key to activate Sml Med or Largeyou reach ZIGZAGactivates autopilotin ZIG ZAG modePILOTWhen you enter ZIGZAG mode the autopilot will use your current position and heading as the center line of the zigzag The autopilot Fishing patterns are designed to work at speeds up to 15kts Check your speed before starting812433book  Page 15  Wednesday March 29 2006  404 PMRaymarine SmartControllerWhen you enter CLOVERLEAF mode the autopilot will use your current position as the center point The autopilot will then steer your boat through a series of starboard turns repeatedly intersecting the CLOVERLEAFSml Med or Largeyou reach CLOVERLEAFactivates autopilotin CLOVERLEAF modePILOTFrom any screenCLOVERLEAF is displayed2 Use the STARBOARD keys to change the size S M or L3 Press the PILOT key to activate You can change the pattern direction in PILOT SETUP See section 3812433book  Page 16  Wednesday March 29 2006  404 PMUser GuideHow do I steer to a fixed wind anglePILOTyou reach WINDactivates autopilot incurrent wind angleIf your boat is equipped with a wind transducer you can set the autopilot to steer at a fixed angle to the wind WIND mode You can adjust this angle to suit your needsFrom any screenPILOT to activate WIND mode3 The current wind angle will be displayed Use the STARBOARD keys to change For best results when heading upwind sail slightly812433book  Page 17  Wednesday March 29 2006  404 PMRaymarine SmartControllerWhen in WIND mode you can use the autopilot to execute a tack maneuver The degree of turn is set by the autopilot Refer to the TACKPILOTFrom any screenTACK is displayed2 Use the STARBOARD keys to select the TACK directionPILOT you reach TACKTACK maneuver812433book  Page 18  Wednesday March 29 2006  404 PMUser GuideWhen used with SMARTSTEER enabled autopilots thepressandhold command will activate SMARTSTEEREven when the autopilot is activated you are are still able to override it If for example you encounter an obstacle or you just wish to change direction by a few degrees This allows you to effectively powersteer your boatWith the autopilot activated1 A brief press of the STARBOARD key will make a direction Use this method for 2 A press and hold of the STARBOARD key will 3 The autopilot will resume on With the autopilot activatedSTANDBY812433book  Page 19  Wednesday March 29 2006  404 PMRaymarine SmartController    Setting upyour SmartController812433book  Page 20  Wednesday March 29 2006  404 PMUser GuideCHANGE PAGESYou can change the appearance content and layout of up to 8 favourite data pages Set these up to best suit your boating needsWhen viewing a favourite page Press and hold theThe selected favourite page can now be configuredFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toCHANGE PAGES and press the SELECT softkey3 Using the updown key scroll to and press the SELECT softkeyACCEPTCONTENTLAYOUTPAGE OFFPAGE 1812433book  Page 21  Wednesday March 29 2006  404 PMRaymarine SmartControllerThe selected favourite page can now be configuredYou can change the layout of each favourite pageIf you only ever use a few favourite pages usethe PAGE ONOFF feature to turn off the restLAYOUTFrom the change page screenselects the next available layoutACCEPTFrom the change page screen1 Using the updown key scroll toLAYOUT2 Press the CHANGE softkey to options The icon to the left 3 Press the ACCEPT softkey to pageXTE       035NMBTWDTWACCEPTCONTENTLAYOUTPAGE OFFPAGE 1812433book  Page 22  Wednesday March 29 2006  404 PMUser GuideACCEPTYou can change the content of each favourite  pageIf you only ever use a few favourite pages usethe PAGE ONOFF feature to turn off the restFrom the change page screenACCEPTDATADEPTH  47FTSPEED  11KTSAWS  23KTSExample screenFrom the change page screen1 Using the updown key scroll CHANGE softkey The current 2 The selected data element will background Where you have displayed use the softkey to wish to change3 Use the updown control to scroll through the available selection When complete press the ACCEPT softkey to save 812433book  Page 23  Wednesday March 29 2006  404 PMRaymarine SmartControlleruse a larger display size to make it stand outUse as many or as few data pages as you like The page onoff option allows you to only display those data pages you really want to seeExample screenACCEPTCONTENTLAYOUTPAGE OFFPAGE 1PAGE ONOFFFrom the change page screenToggles Page OnOffFrom the change page screen1 Using the updown key scroll toPAGE ON or PAGE OFF2 The label displayed indicated selected page This will also the icon 3 Press the CHANGE softkey to 812433book  Page 24  Wednesday March 29 2006  404 PMUser GuideHow do I change the pattern directionPILOT SETTINGSPATTERNYou can change the autopilot pattern directionExample screenTurns to starboard clockwisepattern directionFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toPILOT SETTINGS and press the SELECT softkey3 Use the updown key to scroll down to the PATTERN option between CLOCKWISE and ANTICLOCKWISE patterns When you are done press BACK to return AUTOLEARN  STARTBOAT TYPE FISHINGPILOT ENABLEDSETTINGS CHANGEPATTERN CLOCKWISEBACKPILOT SETTINGS812433book  Page 25  Wednesday March 29 2006  404 PMRaymarine SmartControllerIf you own a powerboat and still require windinformation set the boat type to SAILExample screenPILOT SETTINGSBOAT TYPEPOWER FISHING SAILYour SmartController can be set to suit the type of vessel to which it is fitted This ensures that the user interface will offer you the most relevant features AUTOLEARN  STARTBOAT TYPE FISHINGPILOT ENABLEDSETTINGS CHANGEPATTERN CLOCKWISEBACKPILOT SETTINGSFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toPILOT SETTINGS and press the SELECT softkey3 Use the updown key to scroll down to the BOAT TYPE between POWER FISHING and SAIL types When you are done press BACK to return to the 812433book  Page 26  Wednesday March 29 2006  404 PMUser GuideTo extend battery life set the backlight to theExample screenYour SmartController can be set to display information appropriate to your current location in the format you require The User Settings menu allows you to set this up  HEADING  MAGDATE USTIME 24 HRTIME OFFSET 50HBACKLIGHT 10SCONTRAST 12BACKUSER SETTINGSFrom the main instrument display1 Press the MENU softkey to using the updown key scroll the SELECT softkey2 Use the updown key to scroll to the item you wish to change  setting value3  When you are done press BACK to return to the main 812433book  Page 27  Wednesday March 29 2006  404 PMRaymarine SmartController    Troubleshooting812433book  Page 28  Wednesday March 29 2006  404 PMUser GuideYou can configure which alarms to you want the SmartController to report From the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll SELECT softkey3 Using the updown key scroll to and press the SELECT softkeyWP ARRIVALLOST FIXPILOTLOW WINDBACKLOCALSYSTEMSYSTEMSYSTEMExample Screen812433book  Page 29  Wednesday March 29 2006  404 PMRaymarine SmartControllerHow do I set up local and system alarmsWhere applicable local alarm threshold values can also be set From the main instrument display1 Press the CHANGE softkey to SYSTEM  alarms to a value set   Alarm not reported3 For LOCAL alarms use the updown key to adjust the alarm threshold valueLOCAL ALARMBACKExample Screen812433book  Page 30  Wednesday March 29 2006  404 PMUser GuideSmartController Alarm messagesWhen the SmartController detects a fault or failure on the system it will activate one of the alarm messages listed in the following table Unless otherwise stated you should respond to the alarm by pressing standby to clear the alarm and return to manual control before you attempt to resolve the problem In some situations the SmartController will raise more than one alarm When you have dealt with the first alarm it will display the next alarmALARM MESSAGEPOSSIBLE CAUSE and SOLUTIONCHECK PILOTSee the main autopilot display head for inforCURRENT LIMITSerious drive failure 226 the drive is taking too much current due to shortcircuit or jamming Check the drive unitDRIVE STOPPEDThe autopilot is unable to turn the rudder this occurs if the weather load on helm is too high or if the rudder position sensor has passed beyond the preset rudder limits or rudder endstopsCheck drive and rudder position sensorLARGE XTEThis alarm will sound when you are more than 03nm from your planned track The alarm will also state  if you are to the PORT or STARBOARD of the trackLRN FAIL 1 2 or 4AutoLearn not completed successfully Failure codes1  AutoLearn has not been carried out2  AutoLearn failed usually due to manual 4  AutoLearn failed probably due to drive or compass failureRepeat the AutoLearn procedure 812433book  Page 31  Wednesday March 29 2006  404 PMRaymarine SmartControllerMOT POW SWAPPEDMotor cables are connected to power terminals and power cables are connected to motor terminals computer Turn off power and swap over connectionsNO DATAThe autopilot is in Track mode and225 the autopilot is not receiving SeaTalk navigation data or 225 your GPS is receiving a low strength signal this will clear when the signal improvesNote The autopilot stops adjusting the heading as soon as it loses dataNO GPS COGThe autopilot is not receiving valid COG data from your GPS system Check the connections and that your GPS unit is setup to send out COG NO GPS FIXYour GPS is receiving a low strength signal this NO PILOTThe controller is not receiving data from the autopilot Check connections and check course computer is switched onOFFCOURSEThis alarm sounds if you have been off course from the locked heading for more than 20 seconds It also states if you are to the PORT or STARBOARD of the intended headingREGISTRATION INCOMPLETEThe registration of your new handset cannot be completed as the system has detected other handsets in the vicinity1 Switch off all other remote handheld units and repeat the registration process2 If this error  persists take your boat to open water with no other vessel within 100 ftrepeat the registration process RG FAILGyroPlus yaw sensor has failed Call a Raymarine service agentALARM MESSAGEPOSSIBLE CAUSE and SOLUTION812433book  Page 32  Wednesday March 29 2006  404 PMUser GuideFault findingAll Raymarine products are designed to provide many years of troublefree operation We also put them through comprehensive testing and quality assurance procedures before shippingIf a fault occurs with your SmartController use the fault finding tables in this section to help identify the problem and provide a solution If you cannot resolve the problem yourself refer to the product support information ROUTE COMPLETEThis sounds on the completion of a track Press PILOT to continue on the same heading or STANDBYSHIPS BATTERYThe ships battery voltage has dropped below acceptable limits replace the batteriesWAYPOINT ADVANCEYou have arrived at a waypoint on your route The autopilot is now requestiong permission to turn onto the next leg press PILOT to acceptSYMPTOMPOSSIBLE CAUSE and SOLUTIONDisplay is blankNo power 226 press  to power up the SmartController or charge the batteriesAutopilot not respondingDrive the boat for 30 seconds at above 25kts and retryCheck autopilot connectionsBoat turns slowly and takes a Rudder gain too low Complete AutoLearn or increase gain settingBoat overshoots when turning Rudder gain too high Complete AutoLearn or decrease gain settingPosition information not receivedNavigator not transmitting the correct position dataThe pilot will not auto advance to the next waypointNo bearing to waypoint information received from the navigatorALARM MESSAGEPOSSIBLE CAUSE and SOLUTION812433book  Page 33  Wednesday March 29 2006  404 PMRaymarine SmartControllerGeneral maintenanceRoutine checksThe SmartController does NOT contain any userserviceable parts If you remove the main cover you will invalidate the warranty  It should be serviced only by authorized Raymarine service technician As a result user maintenance is limited to the following checks225make sure all cable connectors are firmly attached225examine for signs of wear or damage 226 replace any damaged cablesCleaning the SmartControllerTake care when cleaning the display Avoid wiping the display screen with a dry cloth as this could scratch the screen coating If necessary only use a mild detergentNever use chemical or abrasive materials to clean the controller If it is dirty wipe it with a clean damp clothDealer Maintenance ProceduresThis section includes procedures that have a significant impact on autopilot operation and can affect your boat222s safety You will not need to follow these procedures in normal operation We therefore recommend that these are only performed by authorised service personnelAccessing the dealer calibration areaFrom the MAIN MENU mode press and hold SELECT for 5 seconds until the dealer calibration screen is displayedUse the updown key to scroll through the various calibration optionsDIAGNOSTICREGISTRATIONBACK812433book  Page 34  Wednesday March 29 2006  404 PMUser GuideHardware and Software version numbersUse this option to display the current hardware revision and the software version numbers for the SmartController At VERSION press the key to display the informationSelf test to start the unit test sequence and then follow the onscreen instructions This will test the display buzzer and button functionsDiagnosticsPILOT to display the the status of the wireless linkHandset RegistrationRaymarine wireless systems require each wireless controller to be  223registered224 to a basestation This registration process is to prevent unauthorised control of your boat by another wireless user Note  There may be instances where you want to move your controller to another boat and use it with another system In this case you will need to deregister from the current system and register with the new system You can do this using the REGISTRATION functionTo register a handsetAt REGISTRATION press If the SmartController is not registered then the display will read HANDSET NOT REGISTERED Press  to start the registration processThe SmartController will now search for the basestation you can press  at any time to stop the search When the basestation is found by the SmartController and registration is complete the display will read REGISTERED TO BASESTATIONCANCELREGNOT812433book  Page 35  Wednesday March 29 2006  404 PMRaymarine SmartControllerNote  For successful registration ensure that all other handheld units on your boat are turned off If you try to register a new handset with others active you will see a REGISTRATION INCOMPLETE messageTo deregister a handsetAt REGISTRATION press SELECTIf the SmartController is already registered then the display will read REGISTERED TO BASESTATION  Press DEREG to continue or  to cancel the operationThe SmartController will attempt to commuicate with the basestation and deregister When complete the display will read HANDSET NOT REGISTEREDIf the SmartController cannot communicate with the basestation then a BASE NOT FOUND message will be displayed It is still possible to deregister the SmartController at this point by pressing  SELECT To leave without deregistering press EXITFactory ResetThis option will clear all settings from the SmartController Press and hold  key for 2 seconds to activate the resetNote  A reset does not alter the registration status of the SmartControllerCONTINUEREGISTRATIONINCOMPLETESEE MANUALEXITDEREGBASESTATIONREADY TO USE812433book  Page 36  Wednesday March 29 2006  404 PMUser GuideProduct SupportRaymarine products are supported by a worldwide network of distributors and Authorized Service Representatives If you encounter any difficulties with this product please contact either your national distributor service representative or the Raymarine Technical Services Call Center Refer to the back cover or wwwraymarinecom for contact details If you cannot trace or rectify the fault contact your nearest Raymarine dealer or Service Center specifyingThe SmartController serial numbers225the controller serial number is printed on its rear cover225the controller software version numbers812433book  Page 37  Wednesday March 29 2006  404 PMRaymarine SmartController    Information812433book  Page 38  Wednesday March 29 2006  404 PMUser GuideProduct installationThis equipment must be installed and operated in accordance with the instructions contained in this handbook Failure to do so could result in poor product performance personal injury andor damage to your boat Before installing the SmartController and basestation check that they are the correct voltage for your boat222s supply As correct performance of the boat222s steering is critical for safety we STRONGLY RECOMMEND that an AuRepresentative fits this product WARNING  Electrical safetyMake sure the power supply is switched off before you make any electrical connections WARNING  CalibrationWe supply this product calibratshould provide initial stable performance for most boats To ensure optimum performance complete the AutoLearn procedure as described in your autopilot handbookWARNING  Navigation aidAlthough we have designed this product to be accurate and reliable many factors can affect its performance As a result it should only be used as an aid to navigation and should never replace common sense and navigational judgement Always maintain a permanent watch so you can respond to situations as they develop 812433book  Page 39  Wednesday March 29 2006  404 PMRaymarine SmartControllerWARNING  Autopilot controllerIf the wireless controller is your only method of operating the autopilot ensure that your system includes a readily g off the autopilot power supplyYour SmartController will add a new dimension to your boating enjoyment However it is the skipper222s responsibility to ensure the safety of the boat at all times by following these basic rules225Ensure that someone is present at the helm AT ALL TIMES to take manual control in an emergency225Make sure that all members of crew know how to disengage the autopilot225Regularly check for other boats and any obstacles to navigation 226 no matter how clear the sea may appear a dangerous situation can develop rapidly225Maintain an accurate record of the boat222s position by using either a navigation aid or visual bearings225Maintain a continuous plot of your boat222s position on a current chart Ensure that the locked autopilot heading will steer the boat clear of all obstacles Make proper allowance for tidal set 226 the autopilot cannot225Even when your autopilot is locked onto the desired track using a navigation aid always maintain a log and make regular positional plots Navigation signals can produce significant errors under some circumstances and the autopilot will not be able to detect these errorsGeneral Care and SafetyDo not leave the controller in places where the temperature could exceed 60272C 140272FDo not attempt to dismantle the SmartController or any of its accessories812433book  Page 40  Wednesday March 29 2006  404 PMUser GuideOnly use with the lanyard supplied with your SmartController or a spare supplied by RaymarineSwitch off your SmartController system at a refuelling point even if you are not refuelling your own vesselThe operation of some medical electronic devices such as hearing aids and pacemakers may be affected if a controller is used next to them Observe the manufacturers recommendations for such devicesRadio frequency energyYour SmartController and base station both low power radio transmitters and receivers When they are turned on they intermittently receive and transmit radio frequency RFy radio wavesExposure to radio frequency energyThe SmartController is designed not to exceed the limits for exposure to RF energy set by national authorities and international health agencies These limits establish permitted levels of radio wave exposure for the general population An example of a radio frequency exposure guideline and standard that the SmartController is designed to conform to is BS EN 503712002  Generic standard to demonstrate the compliance of lowpower electronic and electrical apparatus with the basic restrictions related to human exposure to electromagnetic fieldsFCC InformationThese devices comply with Part 15 of the FCC Rules Operation is subject to the following two conditions 1ese devices may not cause harmful interference and 2ese devices must accept interference received including interference that may cause undesired operationChanges or modifications to this equipment not expressly approved in writing by Raymarine could violate compliance with FCC rules and void the users authority to operate the equipment812433book  Page 41  Wednesday March 29 2006  404 PMRaymarine SmartControllerWaste from Electrical and Electronic Equipment WEEEectiveThe Waste from Electrical and Electronic Equipment WEEEDirective requires the recycling of waste electrical and electronic equipment Whilst the WEEE Directive does not apply to some of Raymarine222s products we support its policy and ask you to be aware of how to dispose of this productThe crossed out wheelie bin symbol illustrated above and found on our products signifies that this product should not be disposed of in general waste or landfillPlease contact your local dealer national distributor or Raymarine Technical Services for information on product disposalThe Smart Controller and Base Station are part of a Raymarine autopilot and instrumentation system intended for use on leisure vessels and small workboatsDeclaration of ConformityHereby Raymarine UK Ltd declare that the SmartController and Basestation are in compliance with the essential requirements and other relevant provisions of the Directive 19995ECThe original Declaration of Conformity certificate may be viewed on the relevant product page at wwwraymarinecom812433book  Page 42  Wednesday March 29 2006  404 PMUser GuideEMC GuidelinesAll Raymarine equipment and accessories are designed to the best industry standards for use in the recreational marine environment Their design and manufacture conforms to the appropriate Electromagnetic Compatibility EMCandards but correct installation is required to ensure that performance is not compromised Connection to other equipmentIf your Raymarine equipment is to be connected to other equipment using a cable not supplied by Raymarine a suppression ferrite MUST always be attached to the cable near to the Raymarine unitTo the best of our knowledge the information in this handbook was correct when it went to press However Raymarine cannot accept liability for any inaccuracies or omissions it may contain In addition our policy of continuous product improvement may change specifications without notice As a result Raymarine cannot accept liability for any differences between the product and the handbook SeaTalk is a Registered Trademark of RaymarineAll other trademarks used in this document are acknowledged251 Copyright Raymarine UK Ltd812433book  Page 43  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812422book  Page 21  Wednesday October 12 2005  259 PM812422book  Page 21  Wednesday October 12 2005  259 PM812422book  Page 21  Wednesday October 12 2005  259 PMwwwraymarinecom31MkyThe digitally encoded machine readable software for producing the Typefaces licensed to you is copyrighted ccccSmartController812422book  Page 21  Wednesday October 12 2005  259 PMUser GuideGetting StartedHow do I power the unit onoff 7Keylock 7Using your SmartControllerHow do I view instrument data 9How do I see all the available data 10How do I use the autopilot 11How do I automatically steer straight 12How do I follow a route  from my GPS 13How do I follow a circle pattern 14How do I follow a zigzag pattern 15How do I follow a cloverleaf pattern 16How do I steer to a fixed wind angle 17How do  I tack using the autopilot 18How do I dodge an obstacle 19Setting up your SmartControllerHow do I change a favourite page 21How do I change the page layout 22How do I change page content 23How do I show or hide pages 24How do I change the pattern direction 25How do I change my boat type  26How do I adjust the handset settings27Alarms and TroubleshootingHow do I set up alarms 29SmartController Alarm messages 31Fault finding 33General maintenance 34Product Support 37Important Safety InformationIntended Use 42Declaration of Conformity 42EMC Guidelines 42Handbook Information 43812433book  Page 3  Wednesday March 29 2006  404 PMRaymarine SmartController    started   812433book  Page 4  Wednesday March 29 2006  404 PMUser GuideBattery power and signal strengthThe battery power 5 levelsindicated on the left hand side of the display Your SmartController will sound an alarm when battery power is running lowWireless signal strength is shown similarly on the right hand side of the displayCharging the SmartControllerBefore using the SmartController for the first time you will need to charge the unit To charge the SmartController simply place it into the cradle pull open the rubber cover on the base  and connect the charging cable CAUTION  Do not use any other cable to charge the unitThe battery power indicator will flash during charging The recommended charge time is approximately five hours Once fully charged the battery indicator will stop flashingThe SmartController can also be charged whenever you wish without affecting performance812433book  Page 5  Wednesday March 29 2006  404 PMRaymarine SmartControllerYour SmartControllerPILOT  Use to activate the autopilotExit cancel or back When off press to power on the ACTION Performs softkey functionset of valuesNAVIGATE STARBOARDUse in PILOT mode to power steer your boat Press and hold for Smart SteerSTANDBY  control of your boat when in PILOT modemodeNAVIGATE PORT Use in PILOT modeto power steer your boat Press and812433book  Page 6  Wednesday March 29 2006  404 PMUser GuideHow do I power the unit onoffPower onPress and hold the button The handset will beep the display will show the first instrument data page and you222re ready to goPower offPress and hold the  button for 3 seconds The display will countdown to zero and will then go blank Note  You cannot power off the handset when the autopilot is in control of your boatKeylockWhen using your SmartController you can temporarily lock the autopilot keys to ensure that it is not accidentally operated Access to the instrument pages is unaffected by the keylockHow do I activate the keylockPress and hold the mode button until you see the 223KEYLOCK ACTIVE224 message A key symbol will also be displayed on the instrument data pagesNote  You cannot activate keylock when the autopilot is in control of your boatHow do I turn off the keylockmode followed by unlock A 223KEYLOCK OFF224 message will be displayed812433book  Page 7  Wednesday March 29 2006  404 PMRaymarine SmartControllerSmartController812433book  Page 8  Wednesday March 29 2006  404 PMUser GuideYour SmartController can display up to 8 pages of boat information Each page can be set to show 12 or 4 data items or to view information graphically When the autopilot is enabled an extra P page is added to the favourites showing autopilot specific informationFrom the main instrument display1 Press the  key to page2 The number of the page hand corner3 Press the softkey to Example Screens             47FT           11KTSXTE       035NMBTWDTWIf you only ever use a few favourite pages usethe PAGE ONOFF feature to turn off the rest812433book  Page 9  Wednesday March 29 2006  404 PMRaymarine SmartControllerHow do I see all the available dataYou can display all the available SeaTalk data in a list for reference This is particularly useful when checking the availability of data or SHOW ALL DATA                ALL DATADEPTH   47  FTSPEED            11 KTSSOG              97  KTSVMG W    KTSBACKWhen planning your favourite pages use SHOWALL DATA to see what data will be shownFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toSHOW ALL DATA and press the SELECT softkey3 All of the available SeaTalk data present value Use the updown key to scroll through the data Where the is no data present Example Screen812433book  Page 10  Wednesday March 29 2006  404 PMUser GuideYou can change your boat type in the autopilotYour autopilot can steer your boat according to one of its preset modes The modes that are available are dependant on your boat and autopilot type Each of these are explained on the following pagesAvailable modesPOWERFISHINGSAILAUTOAUTOAUTOZIGZAGCLOVERTRACKTRACKTRACKTACK812433book  Page 11  Wednesday March 29 2006  404 PMRaymarine SmartControllerHow do I automatically steer straightFrom any screen1 Steer your boat onto the desired 2 Check that there are no obstructions 3 Press the PILOT key to activate PILOTActivates autopilot inAUTO modeSTANDBYTo continue on your current heading under autopilot control use the AUTO mode This will steer you in a straight line ahead until commanded otherwise AUTO mode can be used in conjunction with SMARTSTEER to give you remote powersteering control of your boatAUTO mode is also available for selection viaAUTO812433book  Page 12  Wednesday March 29 2006  404 PMUser GuideHow do I follow a route from my GPSTRACKactivates autopilotin TRACK modeyou reach TRACKPress when asked toPILOTPILOTPress when asked toYour autopilot can follow a route that you have previously set on your GPS or Chartplotter Ensure that your GPSChartplotter is sending valid SeaTalk or NMEA 0183 dataFrom any screenTRACK is displayedPILOT to activate TRACK mode3 If a valid route is received the it will steer to Press PILOT Note  At each waypoint required Press PILOT PILOT812433book  Page 13  Wednesday March 29 2006  404 PMRaymarine SmartControllerHow do I follow a circle patternWhen you select CIRCLE mode your current position is marked as the center of the circle pattern Your autopilot will now gently steer your boat into the circle of the selected sizeFrom any screen2 Use the STARBOARD keys to change the size S M or L3 Press the PILOT key to activate Sml Med or Largeactivates autopilotPILOTIf your circles are gradually becoming larger increase812433book  Page 14  Wednesday March 29 2006  404 PMUser GuideZIGZAGFrom any screenZIGZAG is displayed2 Use the STARBOARD keys to change the size S M or L3 Press the PILOT key to activate Sml Med or Largeyou reach ZIGZAGactivates autopilotin ZIG ZAG modePILOTWhen you enter ZIGZAG mode the autopilot will use your current position and heading as the center line of the zigzag The autopilot Fishing patterns are designed to work at speeds up to 15kts Check your speed before starting812433book  Page 15  Wednesday March 29 2006  404 PMRaymarine SmartControllerWhen you enter CLOVERLEAF mode the autopilot will use your current position as the center point The autopilot will then steer your boat through a series of starboard turns repeatedly intersecting the CLOVERLEAFSml Med or Largeyou reach CLOVERLEAFactivates autopilotin CLOVERLEAF modePILOTFrom any screenCLOVERLEAF is displayed2 Use the STARBOARD keys to change the size S M or L3 Press the PILOT key to activate You can change the pattern direction in PILOT SETUP See section 3812433book  Page 16  Wednesday March 29 2006  404 PMUser GuideHow do I steer to a fixed wind anglePILOTyou reach WINDactivates autopilot incurrent wind angleIf your boat is equipped with a wind transducer you can set the autopilot to steer at a fixed angle to the wind WIND mode You can adjust this angle to suit your needsFrom any screenPILOT to activate WIND mode3 The current wind angle will be displayed Use the STARBOARD keys to change For best results when heading upwind sail slightly812433book  Page 17  Wednesday March 29 2006  404 PMRaymarine SmartControllerWhen in WIND mode you can use the autopilot to execute a tack maneuver The degree of turn is set by the autopilot Refer to the TACKPILOTFrom any screenTACK is displayed2 Use the STARBOARD keys to select the TACK directionPILOT you reach TACKTACK maneuver812433book  Page 18  Wednesday March 29 2006  404 PMUser GuideWhen used with SMARTSTEER enabled autopilots thepressandhold command will activate SMARTSTEEREven when the autopilot is activated you are are still able to override it If for example you encounter an obstacle or you just wish to change direction by a few degrees This allows you to effectively powersteer your boatWith the autopilot activated1 A brief press of the STARBOARD key will make a direction Use this method for 2 A press and hold of the STARBOARD key will 3 The autopilot will resume on With the autopilot activatedSTANDBY812433book  Page 19  Wednesday March 29 2006  404 PMRaymarine SmartController    Setting upyour SmartController812433book  Page 20  Wednesday March 29 2006  404 PMUser GuideCHANGE PAGESYou can change the appearance content and layout of up to 8 favourite data pages Set these up to best suit your boating needsWhen viewing a favourite page Press and hold theThe selected favourite page can now be configuredFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toCHANGE PAGES and press the SELECT softkey3 Using the updown key scroll to and press the SELECT softkeyACCEPTCONTENTLAYOUTPAGE OFFPAGE 1812433book  Page 21  Wednesday March 29 2006  404 PMRaymarine SmartControllerThe selected favourite page can now be configuredYou can change the layout of each favourite pageIf you only ever use a few favourite pages usethe PAGE ONOFF feature to turn off the restLAYOUTFrom the change page screenselects the next available layoutACCEPTFrom the change page screen1 Using the updown key scroll toLAYOUT2 Press the CHANGE softkey to options The icon to the left 3 Press the ACCEPT softkey to pageXTE       035NMBTWDTWACCEPTCONTENTLAYOUTPAGE OFFPAGE 1812433book  Page 22  Wednesday March 29 2006  404 PMUser GuideACCEPTYou can change the content of each favourite  pageIf you only ever use a few favourite pages usethe PAGE ONOFF feature to turn off the restFrom the change page screenACCEPTDATADEPTH  47FTSPEED  11KTSAWS  23KTSExample screenFrom the change page screen1 Using the updown key scroll CHANGE softkey The current 2 The selected data element will background Where you have displayed use the softkey to wish to change3 Use the updown control to scroll through the available selection When complete press the ACCEPT softkey to save 812433book  Page 23  Wednesday March 29 2006  404 PMRaymarine SmartControlleruse a larger display size to make it stand outUse as many or as few data pages as you like The page onoff option allows you to only display those data pages you really want to seeExample screenACCEPTCONTENTLAYOUTPAGE OFFPAGE 1PAGE ONOFFFrom the change page screenToggles Page OnOffFrom the change page screen1 Using the updown key scroll toPAGE ON or PAGE OFF2 The label displayed indicated selected page This will also the icon 3 Press the CHANGE softkey to 812433book  Page 24  Wednesday March 29 2006  404 PMUser GuideHow do I change the pattern directionPILOT SETTINGSPATTERNYou can change the autopilot pattern directionExample screenTurns to starboard clockwisepattern directionFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toPILOT SETTINGS and press the SELECT softkey3 Use the updown key to scroll down to the PATTERN option between CLOCKWISE and ANTICLOCKWISE patterns When you are done press BACK to return AUTOLEARN  STARTBOAT TYPE FISHINGPILOT ENABLEDSETTINGS CHANGEPATTERN CLOCKWISEBACKPILOT SETTINGS812433book  Page 25  Wednesday March 29 2006  404 PMRaymarine SmartControllerIf you own a powerboat and still require windinformation set the boat type to SAILExample screenPILOT SETTINGSBOAT TYPEPOWER FISHING SAILYour SmartController can be set to suit the type of vessel to which it is fitted This ensures that the user interface will offer you the most relevant features AUTOLEARN  STARTBOAT TYPE FISHINGPILOT ENABLEDSETTINGS CHANGEPATTERN CLOCKWISEBACKPILOT SETTINGSFrom the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll toPILOT SETTINGS and press the SELECT softkey3 Use the updown key to scroll down to the BOAT TYPE between POWER FISHING and SAIL types When you are done press BACK to return to the 812433book  Page 26  Wednesday March 29 2006  404 PMUser GuideTo extend battery life set the backlight to theExample screenYour SmartController can be set to display information appropriate to your current location in the format you require The User Settings menu allows you to set this up  HEADING  MAGDATE USTIME 24 HRTIME OFFSET 50HBACKLIGHT 10SCONTRAST 12BACKUSER SETTINGSFrom the main instrument display1 Press the MENU softkey to using the updown key scroll the SELECT softkey2 Use the updown key to scroll to the item you wish to change  setting value3  When you are done press BACK to return to the main 812433book  Page 27  Wednesday March 29 2006  404 PMRaymarine SmartController    Troubleshooting812433book  Page 28  Wednesday March 29 2006  404 PMUser GuideYou can configure which alarms to you want the SmartController to report From the main instrument display1 Press the MENU softkey to 2 Using the updown key scroll SELECT softkey3 Using the updown key scroll to and press the SELECT softkeyWP ARRIVALLOST FIXPILOTLOW WINDBACKLOCALSYSTEMSYSTEMSYSTEMExample Screen812433book  Page 29  Wednesday March 29 2006  404 PMRaymarine SmartControllerHow do I set up local and system alarmsWhere applicable local alarm threshold values can also be set From the main instrument display1 Press the CHANGE softkey to SYSTEM  alarms to a value set   Alarm not reported3 For LOCAL alarms use the updown key to adjust the alarm threshold valueLOCAL ALARMBACKExample Screen812433book  Page 30  Wednesday March 29 2006  404 PMUser GuideSmartController Alarm messagesWhen the SmartController detects a fault or failure on the system it will activate one of the alarm messages listed in the following table Unless otherwise stated you should respond to the alarm by pressing standby to clear the alarm and return to manual control before you attempt to resolve the problem In some situations the SmartController will raise more than one alarm When you have dealt with the first alarm it will display the next alarmALARM MESSAGEPOSSIBLE CAUSE and SOLUTIONCHECK PILOTSee the main autopilot display head for inforCURRENT LIMITSerious drive failure 226 the drive is taking too much current due to shortcircuit or jamming Check the drive unitDRIVE STOPPEDThe autopilot is unable to turn the rudder this occurs if the weather load on helm is too high or if the rudder position sensor has passed beyond the preset rudder limits or rudder endstopsCheck drive and rudder position sensorLARGE XTEThis alarm will sound when you are more than 03nm from your planned track The alarm will also state  if you are to the PORT or STARBOARD of the trackLRN FAIL 1 2 or 4AutoLearn not completed successfully Failure codes1  AutoLearn has not been carried out2  AutoLearn failed usually due to manual 4  AutoLearn failed probably due to drive or compass failureRepeat the AutoLearn procedure 812433book  Page 31  Wednesday March 29 2006  404 PMRaymarine SmartControllerMOT POW SWAPPEDMotor cables are connected to power terminals and power cables are connected to motor terminals computer Turn off power and swap over connectionsNO DATAThe autopilot is in Track mode and225 the autopilot is not receiving SeaTalk navigation data or 225 your GPS is receiving a low strength signal this will clear when the signal improvesNote The autopilot stops adjusting the heading as soon as it loses dataNO GPS COGThe autopilot is not receiving valid COG data from your GPS system Check the connections and that your GPS unit is setup to send out COG NO GPS FIXYour GPS is receiving a low strength signal this NO PILOTThe controller is not receiving data from the autopilot Check connections and check course computer is switched onOFFCOURSEThis alarm sounds if you have been off course from the locked heading for more than 20 seconds It also states if you are to the PORT or STARBOARD of the intended headingREGISTRATION INCOMPLETEThe registration of your new handset cannot be completed as the system has detected other handsets in the vicinity1 Switch off all other remote handheld units and repeat the registration process2 If this error  persists take your boat to open water with no other vessel within 100 ftrepeat the registration process RG FAILGyroPlus yaw sensor has failed Call a Raymarine service agentALARM MESSAGEPOSSIBLE CAUSE and SOLUTION812433book  Page 32  Wednesday March 29 2006  404 PMUser GuideFault findingAll Raymarine products are designed to provide many years of troublefree operation We also put them through comprehensive testing and quality assurance procedures before shippingIf a fault occurs with your SmartController use the fault finding tables in this section to help identify the problem and provide a solution If you cannot resolve the problem yourself refer to the product support information ROUTE COMPLETEThis sounds on the completion of a track Press PILOT to continue on the same heading or STANDBYSHIPS BATTERYThe ships battery voltage has dropped below acceptable limits replace the batteriesWAYPOINT ADVANCEYou have arrived at a waypoint on your route The autopilot is now requestiong permission to turn onto the next leg press PILOT to acceptSYMPTOMPOSSIBLE CAUSE and SOLUTIONDisplay is blankNo power 226 press  to power up the SmartController or charge the batteriesAutopilot not respondingDrive the boat for 30 seconds at above 25kts and retryCheck autopilot connectionsBoat turns slowly and takes a Rudder gain too low Complete AutoLearn or increase gain settingBoat overshoots when turning Rudder gain too high Complete AutoLearn or decrease gain settingPosition information not receivedNavigator not transmitting the correct position dataThe pilot will not auto advance to the next waypointNo bearing to waypoint information received from the navigatorALARM MESSAGEPOSSIBLE CAUSE and SOLUTION812433book  Page 33  Wednesday March 29 2006  404 PMRaymarine SmartControllerGeneral maintenanceRoutine checksThe SmartController does NOT contain any userserviceable parts If you remove the main cover you will invalidate the warranty  It should be serviced only by authorized Raymarine service technician As a result user maintenance is limited to the following checks225make sure all cable connectors are firmly attached225examine for signs of wear or damage 226 replace any damaged cablesCleaning the SmartControllerTake care when cleaning the display Avoid wiping the display screen with a dry cloth as this could scratch the screen coating If necessary only use a mild detergentNever use chemical or abrasive materials to clean the controller If it is dirty wipe it with a clean damp clothDealer Maintenance ProceduresThis section includes procedures that have a significant impact on autopilot operation and can affect your boat222s safety You will not need to follow these procedures in normal operation We therefore recommend that these are only performed by authorised service personnelAccessing the dealer calibration areaFrom the MAIN MENU mode press and hold SELECT for 5 seconds until the dealer calibration screen is displayedUse the updown key to scroll through the various calibration optionsDIAGNOSTICREGISTRATIONBACK812433book  Page 34  Wednesday March 29 2006  404 PMUser GuideHardware and Software version numbersUse this option to display the current hardware revision and the software version numbers for the SmartController At VERSION press the key to display the informationSelf test to start the unit test sequence and then follow the onscreen instructions This will test the display buzzer and button functionsDiagnosticsPILOT to display the the status of the wireless linkHandset RegistrationRaymarine wireless systems require each wireless controller to be  223registered224 to a basestation This registration process is to prevent unauthorised control of your boat by another wireless user Note  There may be instances where you want to move your controller to another boat and use it with another system In this case you will need to deregister from the current system and register with the new system You can do this using the REGISTRATION functionTo register a handsetAt REGISTRATION press If the SmartController is not registered then the display will read HANDSET NOT REGISTERED Press  to start the registration processThe SmartController will now search for the basestation you can press  at any time to stop the search When the basestation is found by the SmartController and registration is complete the display will read REGISTERED TO BASESTATIONCANCELREGNOT812433book  Page 35  Wednesday March 29 2006  404 PMRaymarine SmartControllerNote  For successful registration ensure that all other handheld units on your boat are turned off If you try to register a new handset with others active you will see a REGISTRATION INCOMPLETE messageTo deregister a handsetAt REGISTRATION press SELECTIf the SmartController is already registered then the display will read REGISTERED TO BASESTATION  Press DEREG to continue or  to cancel the operationThe SmartController will attempt to commuicate with the basestation and deregister When complete the display will read HANDSET NOT REGISTEREDIf the SmartController cannot communicate with the basestation then a BASE NOT FOUND message will be displayed It is still possible to deregister the SmartController at this point by pressing  SELECT To leave without deregistering press EXITFactory ResetThis option will clear all settings from the SmartController Press and hold  key for 2 seconds to activate the resetNote  A reset does not alter the registration status of the SmartControllerCONTINUEREGISTRATIONINCOMPLETESEE MANUALEXITDEREGBASESTATIONREADY TO USE812433book  Page 36  Wednesday March 29 2006  404 PMUser GuideProduct SupportRaymarine products are supported by a worldwide network of distributors and Authorized Service Representatives If you encounter any difficulties with this product please contact either your national distributor service representative or the Raymarine Technical Services Call Center Refer to the back cover or wwwraymarinecom for contact details If you cannot trace or rectify the fault contact your nearest Raymarine dealer or Service Center specifyingThe SmartController serial numbers225the controller serial number is printed on its rear cover225the controller software version numbers812433book  Page 37  Wednesday March 29 2006  404 PMRaymarine SmartController    Information812433book  Page 38  Wednesday March 29 2006  404 PMUser GuideProduct installationThis equipment must be installed and operated in accordance with the instructions contained in this handbook Failure to do so could result in poor product performance personal injury andor damage to your boat Before installing the SmartController and basestation check that they are the correct voltage for your boat222s supply As correct performance of the boat222s steering is critical for safety we STRONGLY RECOMMEND that an AuRepresentative fits this product WARNING  Electrical safetyMake sure the power supply is switched off before you make any electrical connections WARNING  CalibrationWe supply this product calibratshould provide initial stable performance for most boats To ensure optimum performance complete the AutoLearn procedure as described in your autopilot handbookWARNING  Navigation aidAlthough we have designed this product to be accurate and reliable many factors can affect its performance As a result it should only be used as an aid to navigation and should never replace common sense and navigational judgement Always maintain a permanent watch so you can respond to situations as they develop 812433book  Page 39  Wednesday March 29 2006  404 PMRaymarine SmartControllerWARNING  Autopilot controllerIf the wireless controller is your only method of operating the autopilot ensure that your system includes a readily g off the autopilot power supplyYour SmartController will add a new dimension to your boating enjoyment However it is the skipper222s responsibility to ensure the safety of the boat at all times by following these basic rules225Ensure that someone is present at the helm AT ALL TIMES to take manual control in an emergency225Make sure that all members of crew know how to disengage the autopilot225Regularly check for other boats and any obstacles to navigation 226 no matter how clear the sea may appear a dangerous situation can develop rapidly225Maintain an accurate record of the boat222s position by using either a navigation aid or visual bearings225Maintain a continuous plot of your boat222s position on a current chart Ensure that the locked autopilot heading will steer the boat clear of all obstacles Make proper allowance for tidal set 226 the autopilot cannot225Even when your autopilot is locked onto the desired track using a navigation aid always maintain a log and make regular positional plots Navigation signals can produce significant errors under some circumstances and the autopilot will not be able to detect these errorsGeneral Care and SafetyDo not leave the controller in places where the temperature could exceed 60272C 140272FDo not attempt to dismantle the SmartController or any of its accessories812433book  Page 40  Wednesday March 29 2006  404 PMUser GuideOnly use with the lanyard supplied with your SmartController or a spare supplied by RaymarineSwitch off your SmartController system at a refuelling point even if you are not refuelling your own vesselThe operation of some medical electronic devices such as hearing aids and pacemakers may be affected if a controller is used next to them Observe the manufacturers recommendations for such devicesRadio frequency energyYour SmartController and base station both low power radio transmitters and receivers When they are turned on they intermittently receive and transmit radio frequency RFy radio wavesExposure to radio frequency energyThe SmartController is designed not to exceed the limits for exposure to RF energy set by national authorities and international health agencies These limits establish permitted levels of radio wave exposure for the general population An example of a radio frequency exposure guideline and standard that the SmartController is designed to conform to is BS EN 503712002  Generic standard to demonstrate the compliance of lowpower electronic and electrical apparatus with the basic restrictions related to human exposure to electromagnetic fieldsFCC InformationThese devices comply with Part 15 of the FCC Rules Operation is subject to the following two conditions 1ese devices may not cause harmful interference and 2ese devices must accept interference received including interference that may cause undesired operationChanges or modifications to this equipment not expressly approved in writing by Raymarine could violate compliance with FCC rules and void the users authority to operate the equipment812433book  Page 41  Wednesday March 29 2006  404 PMRaymarine SmartControllerWaste from Electrical and Electronic Equipment WEEEectiveThe Waste from Electrical and Electronic Equipment WEEEDirective requires the recycling of waste electrical and electronic equipment Whilst the WEEE Directive does not apply to some of Raymarine222s products we support its policy and ask you to be aware of how to dispose of this productThe crossed out wheelie bin symbol illustrated above and found on our products signifies that this product should not be disposed of in general waste or landfillPlease contact your local dealer national distributor or Raymarine Technical Services for information on product disposalThe Smart Controller and Base Station are part of a Raymarine autopilot and instrumentation system intended for use on leisure vessels and small workboatsDeclaration of ConformityHereby Raymarine UK Ltd declare that the SmartController and Basestation are in compliance with the essential requirements and other relevant provisions of the Directive 19995ECThe original Declaration of Conformity certificate may be viewed on the relevant product page at wwwraymarinecom812433book  Page 42  Wednesday March 29 2006  404 PMUser GuideEMC GuidelinesAll Raymarine equipment and accessories are designed to the best industry standards for use in the recreational marine environment Their design and manufacture conforms to the appropriate Electromagnetic Compatibility EMCandards but correct installation is required to ensure that performance is not compromised Connection to other equipmentIf your Raymarine equipment is to be connected to other equipment using a cable not supplied by Raymarine a suppression ferrite MUST always be attached to the cable near to the Raymarine unitTo the best of our knowledge the information in this handbook was correct when it went to press However Raymarine cannot accept liability for any inaccuracies or omissions it may contain In addition our policy of continuous product improvement may change specifications without notice As a result Raymarine cannot accept liability for any differences between the product and the handbook SeaTalk is a Registered Trademark of RaymarineAll other trademarks used in this document are acknowledged251 Copyright Raymarine UK Ltd812433book  Page 43  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812422book  Page 21  Wednesday October 12 2005  259 PM812422book  Page 21  Wednesday October 12 2005  259 PM812422book  Page 21  Wednesday October 12 2005  259 PMwwwraymarinecomlocaKLmaxp nameV3ugpost prep8MF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3httpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10cc31MkyThe digitally encoded machine readable software for producing the Typefaces licensed to you is copyrighted cccc812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM812422book  Page 21  Wednesday October 12 2005  259 PMlocaKLmaxp nameV3ugpost prep8MF 6gGH105FTI2ICTX UUUU3U3U3U3U3U39U U3httpswwwverisigncomrpa0U00U0HOcRgFMz 02h2Wjc7zwvj6A5jj5EZ38nMbTFUpu00jO0H0p10cc00U00U0pirQMr0p10c07SubCA0UF0U00HEXAHwwWEj9YM88dBQmDdd7JavvVTKyI2iTuMd0dIDBqEkBVNUplTKfzG1SsHCc612yz0iJTY00aC40H010UUS10UWashington10URedmond10UMicrosoft Corporation10cctr0p10cc31MkyThe digitally encoded machine readable software for producing the Typefaces licensed to you is copyrighted cccc812433book  Page 44  Wednesday March 29 2006  404 PM812433book  Page 44  Wednesday March 29 2006  404 PM

Ad by Google

Disclaimer:
The information on this web site has not been checked for accuracy. It is for entertainment purposes only and should be independently verified before using for any other reason. There are five sources. 1) Documents and manuals from a variety of sources. These have not been checked for accuracy and in many cases have not even been read by anyone associated with L-36.com. I have no idea of they are useful or accurate, I leave that to the reader. 2) Articles others have written and submitted. If you have questions on these, please contact the author. 3) Articles that represent my personal opinions. These are intended to promote thought and for entertainment. These are not intended to be fact, they are my opinions. 4) Small programs that generate result presented on a web page. Like any computer program, these may and in some cases do have errors. Almost all of these also make simplifying assumptions so they are not totally accurate even if there are no errors. Please verify all results. 5) Weather information is from numerious of sources and is presented automatically. It is not checked for accuracy either by anyone at L-36.com or by the source which is typically the US Government. See the NOAA web site for their disclaimer. Finally, tide and current data on this site is from 2007 and 2008 data bases, which may contain even older data. Changes in harbors due to building or dredging change tides and currents and for that reason many of the locations presented are no longer supported by newer data bases. For example, there is very little tidal current data in newer data bases so current data is likely wrong to some extent. This data is NOT FOR NAVIGATION. See the XTide disclaimer for details. In addition, tide and current are influenced by storms, river flow, and other factors beyond the ability of any predictive program.